LMPD Database

LMP000979

Record overview

LMPD ID	LMP000979
Gene ID	1208
Species	Homo sapiens (Human)
Gene Name	colipase, pancreatic
Gene Symbol	CLPS
Synonyms	-
Alternate names	colipase; pancreatic colipase preproprotein
Chromosome	6
Map Location	6p21.31
Summary	The protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Orthologs	View orthologs and multiple alignments for CLPS

Proteins

colipase isoform 1 preproprotein

Refseq ID:	NP_001823
Protein GI:	4502895
UniProt ID:	P04118
mRNA ID:	NM_001832
Length:	112
RefSeq Status:	REVIEWED

`MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTN FGICHDAGRSKQ`

sig_peptide: 1..17
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 1860
peptide sequence: 
MEKILILLLVALSVAYA

mat_peptide: 23..71
product: colipase isoform 3
calculated_mol_wt: 5338
peptide sequence: 
GIIINLTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ

sig_peptide: 1..17
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 1860
peptide sequence: 
MEKILILLLVALSVAYA

mat_peptide: 23..112
product: colipase isoform 1
calculated_mol_wt: 9633
peptide sequence: 
GIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ