LMPD Database

LMP003790

Record overview

LMPD IDLMP003790
Gene ID8818
SpeciesHomo sapiens (Human)
Gene Namedolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Gene SymbolDPM2
SynonymsCDG1U
Alternate namesdolichol phosphate-mannose biosynthesis regulatory protein; DPM synthase subunit 2; DPM synthase complex subunit; dolichol-phosphate mannose synthase subunit 2
Chromosome9
Map Location9q34.13
SummaryDolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. The protein encoded by this gene is a hydrophobic protein that contains 2 predicted transmembrane domains and a putative ER localization signal near the C terminus. This protein associates with DPM1 in vivo and is required for the ER localization and stable expression of DPM1 and also enhances the binding of dolichol-phosphate to DPM1. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for DPM2

Proteins

dolichol phosphate-mannose biosynthesis regulatory protein
Refseq ID:NP_003854
Protein GI:4503365
UniProt ID:O94777
mRNA ID:NM_003863
Length:84
RefSeq Status:REVIEWED
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKTKRVTKKAQ