LMPD Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
LMP010666

Record overview

LMPD IDLMP010666
Gene ID824322
SpeciesArabidopsis thaliana (Arabidopsis)
Gene Namenon-specific lipid-transfer protein 12
Gene SymbolLTP12
Synonymslipid transfer protein 12; LTP12; T18N14.1
Alternate namesnon-specific lipid-transfer protein 12
Chromosome3
SummaryEncodes a member of the lipid transfer protein family. Proteins of this family are generally small (~9 kD), basic, expressed abundantly and contain eight Cys residues. The proteins can bind fatty acids and acylCoA esters and can transfer several different phospholipids. They are localized to the cell wall. The LTP12 promoter is active exclusively in the tapetum during the uninucleate microspore and bicellular pollen stages. Predicted to be a member of PR-14 pathogenesis-related protein family with the following members: At2g38540/LTP1, At2g38530/LTP2, At5g59320/LTP3, At5g59310/LTP4, At3g51600/LTP5, At3g08770/LTP6, At2g15050/LTP7, At2g18370/LTP8, At2g15325/LTP9, At5g01870/LTP10, At4g33355/LTP11, At3g51590/LTP12, At5g44265/LTP13, At5g62065/LTP14, At4g08530/LTP15.
OrthologsView orthologs and multiple alignments for LTP12

Proteins

non-specific lipid-transfer protein 12
Refseq ID:NP_190727
Protein GI:15230531
UniProt ID:Q9SCZ0
mRNA ID:NM_115018
Length:119
RefSeq Status:REVIEWED
MAFTPKIITCLIVLTIYMASPTESTIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGV
SIPYPISFSTNCDSISTAV