LIPID MAPS® Maintenance
Routine maintenance of the LIPID MAPS® web systems is scheduled for Friday 25th September, 2020.
LIPID MAPS® services will be 'at risk' all day. We apologise for any inconvenience this may cause.

LMPD Database

LMP000634

Record overview

LMPD IDLMP000634
Gene ID16975
SpeciesMus musculus(Mouse)
Gene Namelow density lipoprotein receptor-related protein 8, apolipoprotein e receptor
Gene SymbolLrp8
Synonyms4932703M08Rik; AA921429; AI848122; ApoER2; Lr8b
Chromosome4
Map Location4 C7|4
OrthologsView orthologs and multiple alignments for Lrp8

Proteins

low-density lipoprotein receptor-related protein 8 precursor
Refseq ID:NP_001074395
Protein GI:124286870
UniProt ID:B1AXJ3
mRNA ID:NM_001080926
Length:870
RefSeq Status:VALIDATED
MGRPELGALRPLALLLLLLLQLQHLSAADPLPGGQGPVKECEEDQFRCRNERCIPLVWRCDEDNDCSDNSDEDDCPKRTCADSDFTCDNGHCIPERWKCD
GEEECPDGSDESKATCSSEECPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCPTSAPGPCRENEFQCGDGTCVLAIKRCNQERDCPDGSDEAGCL
QESTCEGPRRFQCKSGECVDGGKVCDDQRDCRDWSDEPQKVCGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCGDIDECQDPDACSQICVNY
KGYFKCECHPGYEMDTLTKNCKAVAGKSPSLIFTNRHEVRRIDLVKRDYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLID
EQLHSPEGLAVDWVHKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMYWSDWGFQAKIEKAGLNGADRQTLVSDNIEWPNGITLDL
LSQRLYWVDSKLHQLSSIDFNGGNRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDIVIFHELKQPKAADACDLS
AQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLASAMTRTVPATTRAPGTTIHDPTYQNHSTETPSQTAAAPHSVNVPRA
PSTSPSTPSPATSNHSQHYGNEGSQMGSTVTAAVIGVIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEEEDELHIGRTAQIGHVYPAA
ISNYDRPLWAEPCLGETRDLEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKCKRVALSLEDDGLP
 
sig_peptide: 1..27
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2951
peptide sequence: 
MGRPELGALRPLALLLLLLLQLQHLSA