Gene/Proteome Database (LMPD)

LMPD ID
LMP002249
Gene ID
60496
Species
Homo sapiens (Human)
Gene Name
aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Gene Symbol
AASDHPPT
Synonyms
AASD-PPT; LYS2; LYS5
Alternate Names
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; LYS5 ortholog', "4'-phosphopantetheinyl transferase;,alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase
Chromosome
11
Map Location
11q22
EC Number
2.7.8.-
Summary
The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for AASDHPPT

Proteins

L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Refseq ID NP_056238
Protein GI 20357568
UniProt ID Q9NRN7
mRNA ID NM_015423
Length 309
RefSeq Status REVIEWED
MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS

Gene Information

Entrez Gene ID
60496
Gene Name
aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Gene Symbol
AASDHPPT
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:Reactome C cytosol
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0008897 IDA:UniProtKB F holo-[acyl-carrier-protein] synthase activity
GO:0000287 IDA:UniProtKB F magnesium ion binding
GO:0009059 IEA:InterPro P macromolecule biosynthetic process
GO:0015939 TAS:Reactome P pantothenate metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0006766 TAS:Reactome P vitamin metabolic process
GO:0006767 TAS:Reactome P water-soluble vitamin metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00770 Pantothenate and CoA biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_169403 Defective BTD causes biotidinase deficiency
REACT_11238 Metabolism of water-soluble vitamins and cofactors
REACT_11172 Vitamin B5 (pantothenate) metabolism

Domain Information

InterPro Annotations

Accession Description
IPR008278 4'-phosphopantetheinyl transferase superfamily

UniProt Annotations

Entry Information

Gene Name
aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Protein Entry
ADPPT_HUMAN
UniProt ID
Q9NRN7
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NRN7-1; Sequence=Displayed; Name=2; IsoId=Q9NRN7-2; Sequence=VSP_055783, VSP_055784; Note=No experimental confirmation available.;
Biophysicochemical Properties Kinetic parameters: KM=0.44 mM for magnesium ; KM=0.025 mM for coenzyme A ;
Catalytic Activity CoA-[4'-phosphopantetheine] + apo-[acyl- carrier-protein] = adenosine 3',5'-bisphosphate + holo-[acyl- carrier-protein].
Cofactor Name=Mg(2+); Xref=ChEBI
Function Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'- phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN. {ECO
Sequence Caution Sequence=AAD34075.1; Type=Frameshift; Positions=34, 63; Evidence= ; Sequence=AAF86879.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the P-Pant transferase superfamily. AcpS family.
Subcellular Location Cytoplasm .
Subunit Monomer. Interacts with FASN.
Tissue Specificity Detected in heart, skeletal muscle, placenta, testis, brain, pancreas, liver and kidney.

Identical and Related Proteins

Unique RefSeq proteins for LMP002249 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20357568 RefSeq NP_056238 309 L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase

Identical Sequences to LMP002249 proteins

Reference Database Accession Length Protein Name
GI:20357568 GenBank JAA13890.1 309 aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [Pan troglodytes]
GI:20357568 GenBank JAA26208.1 309 aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [Pan troglodytes]
GI:20357568 GenBank JAA33393.1 309 aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [Pan troglodytes]
GI:20357568 GenBank AIC52078.1 309 AASDHPPT, partial [synthetic construct]
GI:20357568 GenBank AIC56953.1 309 AASDHPPT, partial [synthetic construct]
GI:20357568 RefSeq XP_010361094.1 309 PREDICTED: L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [Rhinopithecus roxellana]

Related Sequences to LMP002249 proteins

Reference Database Accession Length Protein Name
GI:20357568 GenBank AAF86879.1 333 HAH-P [Homo sapiens]
GI:20357568 GenBank EHH23389.1 309 hypothetical protein EGK_06849 [Macaca mulatta]
GI:20357568 GenBank EHH56717.1 309 hypothetical protein EGM_06182 [Macaca fascicularis]
GI:20357568 GenBank AFE64034.1 309 L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [Macaca mulatta]
GI:20357568 GenBank AFE64035.1 309 L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [Macaca mulatta]
GI:20357568 RefSeq XP_008018907.1 309 PREDICTED: L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [Chlorocebus sabaeus]