Gene/Proteome Database (LMPD)
LMPD ID
LMP011067
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
xyloglucan endotransglucosylase/hydrolase
Gene Symbol
Synonyms
ATXTR8; XTH31; XTR8; xyloglucan endo-transglycosylase-related 8; XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31
Alternate Names
xyloglucan endotransglucosylase/hydrolase
Chromosome
3
EC Number
2.4.1.207
Summary
xyloglucan endo-transglycosylase
Orthologs
Proteins
| xyloglucan endotransglucosylase/hydrolase | |
|---|---|
| Refseq ID | NP_190085 |
| Protein GI | 15230574 |
| UniProt ID | P93046 |
| mRNA ID | NM_114368 |
| Length | 293 |
| RefSeq Status | REVIEWED |
| MALSLIFLALLVLCPSSGHSQRSPSPGYYPSSRVPTSPFDREFRTLWGSQHQRREQDVVTLWLDKSTGSGFKSLRPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQEHPGDHDEVDIEFLGTTPGKPYSLQTNVFVRGSGDRNVIGREMKFTLWFDPTQDFHHYAILWNPNQIVFFVDDVPIRTYNRKNEAIFPTRPMWVYGSIWDASDWATENGRIKADYRYQPFVAKYKNFKLAGCTADSSSSCRPPSPAPMRNRGLSRQQMAALTWAQRNFLVYNYCHDPKRDHTQTPEC | |
Gene Information
Entrez Gene ID
Gene Name
xyloglucan endotransglucosylase/hydrolase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0048046 | IEA:UniProtKB-KW | C | apoplast |
| GO:0005618 | IEA:UniProtKB-KW | C | cell wall |
| GO:0033946 | IDA:TAIR | F | xyloglucan-specific endo-beta-1,4-glucanase activity |
| GO:0016762 | IEA:UniProtKB-EC | F | xyloglucan:xyloglucosyl transferase activity |
| GO:0016998 | IMP:TAIR | P | cell wall macromolecule catabolic process |
| GO:0071555 | IEA:UniProtKB-KW | P | cell wall organization |
| GO:0006073 | IEA:InterPro | P | cellular glucan metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
xyloglucan endotransglucosylase/hydrolase
Protein Entry
XTH31_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan. |
| Developmental Stage | Expressed in germinating seeds from 24 hours after imbibation, and reaches a maximum level at 72 hours. After 96 hours, it then decreases. {ECO:0000269|Ref.1}. |
| Function | Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues (By similarity). {ECO:0000250}. |
| Induction | By gibberellins (Probable). Not induced by auxin. {ECO:0000269|Ref.1, ECO:0000305}. |
| Miscellaneous | In contrast to group 1 and group 2 endotransglucosylase/hydrolase proteins, it may not contain the ligase activity, and may catalyze endohydrolysis xyloglucan polymers only. |
| Ptm | Contains at least one intrachain disulfide bond essential for its enzymatic activity. {ECO:0000250}. |
| Similarity | Belongs to the glycosyl hydrolase 16 family. XTH group 3 subfamily. {ECO:0000305}. |
| Subcellular Location | Secreted, cell wall {ECO:0000305}. Secreted, extracellular space, apoplast {ECO:0000305}. |
| Tissue Specificity | Predominantly expressed in root. Weakly expressed in influorescence stems. {ECO:0000269|PubMed:11673616, ECO:0000269|Ref.1}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011067 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15230574 | RefSeq | NP_190085 | 293 | xyloglucan endotransglucosylase/hydrolase |
Identical Sequences to LMP011067 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15230574 | GenBank | AAP13434.1 | 293 | At3g44990 [Arabidopsis thaliana] |
| GI:15230574 | GenBank | ADT60567.1 | 293 | Sequence 2024 from patent US 7847156 |
| GI:15230574 | GenBank | AEE77976.1 | 293 | xyloglucan endotransglucosylase/hydrolase [Arabidopsis thaliana] |
| GI:15230574 | GenBank | AFX49713.1 | 293 | Sequence 51546 from patent US 8299318 |
| GI:15230574 | GenBank | AGF14746.1 | 293 | Sequence 14165 from patent US 8362325 |
| GI:15230574 | SwissProt | P93046.2 | 293 | RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase protein 31; Short=At-XTH31; Short=AtXTR8; Short=XTH-31; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP011067 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15230574 | EMBL | CAA63553.1 | 293 | xyloglucan endo-transglycosylase [Arabidopsis thaliana] |
| GI:15230574 | GenBank | ACX05487.1 | 293 | Sequence 28691 from patent US 7569389 |
| GI:15230574 | RefSeq | XP_006291596.1 | 293 | hypothetical protein CARUB_v10017750mg [Capsella rubella] |
| GI:15230574 | RefSeq | XP_010503152.1 | 293 | PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 31 [Camelina sativa] |
| GI:15230574 | RefSeq | XP_010514834.1 | 293 | PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 31 isoform X1 [Camelina sativa] |
| GI:15230574 | RefSeq | XP_010425930.1 | 293 | PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 31 [Camelina sativa] |