LIPID MAPSĀ® Gene/Proteome Database (LMPD)

Introduction | Overview of Interfaces | Browse | Search | Download

LMPD Record

LMP000144

Record overview

LMPD IDLMP000144
Gene ID11812
SpeciesMus musculus(Mouse)
Gene Nameapolipoprotein C-I
Gene SymbolApoc1
SynonymsApo-CIB; ApoC-IB; apo-CI; apoC-I
Alternate namesapolipoprotein C-I; apolipoprotein C1
Chromosome7
Map Location7 A3|7 9.94 cM
SummaryThis gene encodes a precursor plasma protein that is cleaved to yield a signal peptide and two alternatively processed mature peptides. The encoded protein, which is a component of chylomicrons, very low density lipoproteins and high density lipoproteins, transports lipids from the intestines to other locations in the body. This protein binds to free fatty acids preventing their uptake by cells. This protein is a cofactor for lecithin cholesterol acyltransferase, an enzyme that catalyzes the conversion of free cholesterol to cholesteryl esters. The encoded protein inhibits the activity of the cholesteryl ester transfer protein which promotes the exchange of neutral lipids between lipoproteins. In humans this gene is associated with risk of coronary artery disease and age-associated memory impairment. Mice lacking this gene demonstrate impaired memory. This gene is clustered with three other apolipoprotein genes on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
OrthologsView orthologs and multiple alignments for Apoc1

Proteins

apolipoprotein C-I precursor
Refseq ID:NP_001103479
Protein GI:158517825
UniProt ID:P34928
mRNA ID:NM_001110009
Length:88
RefSeq Status:REVIEWED
MRLFIALPVLIVVVAMTLEGPAPAQAAPDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
 
apolipoprotein C-I precursor
Refseq ID:NP_031495
Protein GI:6680704
UniProt ID:P34928
mRNA ID:NM_007469
Length:88
RefSeq Status:REVIEWED
Protein sequence is identical to GI:158517825 (mRNA isoform)
 
sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2721
peptide sequence: 
MRLFIALPVLIVVVAMTLEGPAPAQA

mat_peptide: 27..88
product: Apolipoprotein C-I
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P34928.1)
calculated_mol_wt: 6993
peptide sequence: 
APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS

mat_peptide: 29..88
product: Truncated apolipoprotein C-I
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P34928.1)
calculated_mol_wt: 6825
peptide sequence: 
DLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS

sig_peptide: 1..26
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2721
peptide sequence: 
MRLFIALPVLIVVVAMTLEGPAPAQA

mat_peptide: 27..88
product: Apolipoprotein C-I
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P34928.1)
calculated_mol_wt: 6993
peptide sequence: 
APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS

mat_peptide: 29..88
product: Truncated apolipoprotein C-I
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P34928.1)
calculated_mol_wt: 6825
peptide sequence: 
DLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS