LIPID MAPSĀ® Gene/Proteome Database (LMPD)

Introduction | Overview of Interfaces | Browse | Search | Download

LMPD Record

LMP001557

Record overview

LMPD IDLMP001557
Gene ID14079
SpeciesMus musculus(Mouse)
Gene Namefatty acid binding protein 2, intestinal
Gene SymbolFabp2
SynonymsFabpi; I-FABP
Alternate namesfatty acid-binding protein, intestinal; intestinal fatty acid binding protein 2; intestinal-type fatty acid-binding protein
Chromosome3
Map Location3 G1|3 53.74 cM
SummaryThe protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. This protein functions within enterocytes, possibly to sense lipids as part of energy homeostasis. In humans polymorphisms are associated with increased fat oxidation and insulin resistance. In mice deficiency of this gene alters body weight in a gender-specific manner and causes hyperinsulinemia. [provided by RefSeq, Jan 2013]
OrthologsView orthologs and multiple alignments for Fabp2

Proteins

fatty acid-binding protein, intestinal
Refseq ID:NP_032006
Protein GI:6679737
UniProt ID:P55050
mRNA ID:NM_007980
Length:132
RefSeq Status:REVIEWED
MAFDGTWKVDRNENYEKFMEKMGINVMKRKLGAHDNLKLTITQDGNKFTVKESSNFRNIDVVFELGVNFPYSLADGTELTGAWTIEGNKLIGKFTRVDNG
KELIAVREVSGNELIQTYTYEGVEAKRFFKKE