LIPID MAPSĀ® Gene/Proteome Database (LMPD)

Introduction | Overview of Interfaces | Browse | Search | Download

LMPD Record

LMP002053

Record overview

LMPD IDLMP002053
Gene ID16204
SpeciesMus musculus(Mouse)
Gene Namefatty acid binding protein 6, ileal (gastrotropin)
Gene SymbolFabp6
SynonymsGT; I-15P; I-BABP; ILBP; ILBP3; Illbp
Alternate namesgastrotropin; ileal lipid-binding protein; fatty acid-binding protein 6; ileal bile acid-binding protein
Chromosome11
Map Location11 B1.1|11 25.81 cM
SummaryThe protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. This protein functions within the ileum, the distal 25-30% of the small intestine, and plays a role in enterohepatic circulation of bile acids and cholesterol homeostasis. In humans, it has been reported that polymorphisms in FABP6 confer a protective effect in obese individuals from developing type 2 diabetes. In mice deficiency of this gene affects bile acid metabolism in a gender-specific manner and was reported to be required for efficient apical to basolateral transport of conjugated bile acids. [provided by RefSeq, Jan 2013]
OrthologsView orthologs and multiple alignments for Fabp6

Proteins

gastrotropin
Refseq ID:NP_032401
Protein GI:6680441
UniProt ID:P51162
mRNA ID:NM_008375
Length:128
RefSeq Status:REVIEWED
MAFSGKYEFESEKNYDEFMKRLGLPGDVIERGRNFKIITEVQQDGQDFTWSQSYSGGNIMSNKFTIGKECEMQTMGGKKFKATVKMEGGKVVAEFPNYHQ
TSEVVGDKLVEISTIGDVTYERVSKRLA