LIPID MAPSĀ® Gene/Proteome Database (LMPD)

Introduction | Overview of Interfaces | Browse | Search | Download

LMPD Record

LMP002064

Record overview

LMPD IDLMP002064
Gene ID9536
SpeciesHomo sapiens (Human)
Gene Nameprostaglandin E synthase
Gene SymbolPTGES
SynonymsMGST-IV; MGST1-L1; MGST1L1; MPGES; PGES; PIG12; PP102; PP1294; TP53I12; mPGES-1
Alternate namesprostaglandin E synthase; MGST1-like 1; p53-induced gene 12 protein; p53-induced apoptosis protein 12; glutathione S-transferase 1-like 1; microsomal prostaglandin E synthase 1; microsomal prostaglandin E synthase-1; tumor protein p53 inducible protein 12; microsomal glutathione S-transferase 1-like 1
Chromosome9
Map Location9q34.3
EC Number5.3.99.3
SummaryThe protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for PTGES

Proteins

prostaglandin E synthase
Refseq ID:NP_004869
Protein GI:4758910
UniProt ID:O14684
mRNA ID:NM_004878
Length:152
RefSeq Status:REVIEWED
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAW
MHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL