LIPID MAPS® Gene/Proteome Database (LMPD)

Introduction | Overview of Interfaces | Browse | Search | Download

LMPD Record

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
LMP002208

Record overview

LMPD IDLMP002208
Gene ID5565
SpeciesHomo sapiens (Human)
Gene Nameprotein kinase, AMP-activated, beta 2 non-catalytic subunit
Gene SymbolPRKAB2
Synonyms-
Alternate names5'-AMP-activated protein kinase subunit beta-2;,AMPK beta 2; AMPK beta-2 chain; AMPK subunit beta-2', "5'-AMP-activated protein kinase, beta-2 subunit;,AMP-activated protein kinase beta 2 non-catalytic subunit
Chromosome1
Map Location1q21.1
SummaryThe protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2013]
OrthologsView orthologs and multiple alignments for PRKAB2

Proteins

5'-AMP-activated protein kinase subunit beta-2
Refseq ID:NP_005390
Protein GI:4885561
UniProt ID:O43741
mRNA ID:NM_005399
Length:272
RefSeq Status:REVIEWED
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWS
TKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEE
RFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI