LIPID MAPSĀ® Gene/Proteome Database (LMPD)

Introduction | Overview of Interfaces | Browse | Search | Download

LMPD Record

LMP002303

Record overview

LMPD IDLMP002303
Gene ID11815
SpeciesMus musculus(Mouse)
Gene Nameapolipoprotein D
Gene SymbolApod
Synonyms-
Chromosome16
Map Location16 B2|16 21.41 cM
SummaryThe protein encoded by this gene is a component of high-density lipoprotein (HDL), but is unique in that it shares greater structural similarity to lipocalin than to other members of the apolipoprotein family, and has a wider tissue expression pattern. The encoded protein is involved in lipid metabolism, and ablation of this gene results in defects in triglyceride metabolism. Elevated levels of this gene product have been observed in multiple tissues of Niemann-Pick disease mouse models, as well as in some tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]
OrthologsView orthologs and multiple alignments for Apod

Proteins

apolipoprotein D precursor
Refseq ID:NP_001288282
Protein GI:672424479
UniProt ID:P51910
mRNA ID:NM_001301353
Length:189
RefSeq Status:REVIEWED
MVTMLMFLATLAGLFTTAKGQNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVS
EPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL
 
apolipoprotein D precursor
Refseq ID:NP_001288283
Protein GI:672424481
UniProt ID:P51910
mRNA ID:NM_001301354
Length:189
RefSeq Status:REVIEWED
Protein sequence is identical to GI:672424479 (mRNA isoform)
 
apolipoprotein D precursor
Refseq ID:NP_031496
Protein GI:75677437
UniProt ID:P51910
mRNA ID:NM_007470
Length:189
RefSeq Status:REVIEWED
Protein sequence is identical to GI:672424479 (mRNA isoform)
 
sig_peptide: 1..20
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2118
peptide sequence: 
MVTMLMFLATLAGLFTTAKG

mat_peptide: 21..189
product: Apolipoprotein D
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P51910.1)
calculated_mol_wt: 19430
peptide sequence: 
QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWI
LATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWI
LATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2118 peptide sequence: MVTMLMFLATLAGLFTTAKG mat_peptide: 21..189 product: Apolipoprotein D experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P51910.1) calculated_mol_wt: 19430 peptide sequence: QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWI
LATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL