LMPD Database

LMP012634

Record overview

LMPD ID	LMP012634
Gene ID	29754
Species	Macaca mulata (Rhesus monkey)
Gene Name	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9)
Gene Symbol	Atp5g1
Alternate names	ATP synthase F(0) complex subunit C1, mitochondrial; ATPase protein 9; ATPase subunit c; ATP synthase proteolipid P1; ATP synthase lipid-binding protein, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9); ATP synthase H+ transporting mitochondrial F0 complex subunit c (subunit 9) isoform 1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1;
Chromosome	10
Map Location	10q31
Summary	isoform of mitochondril ATP synthase subunit 9; increased expression occurs in response to ethanol consumption [RGD, Feb 2006]
Orthologs	View orthologs and multiple alignments for Atp5g1

Proteins

ATP synthase F(0) complex subunit C1, mitochondrial precursor

Refseq ID:	NP_059007
Protein GI:	8392939
UniProt ID:	Q06645
mRNA ID:	NM_017311
Length:	136
RefSeq Status:

`MQTTKALLISPVLIRSCTRGLIRPVSASLLSRPEAPSKKPSCCSSPLQVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARN PSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM`


transit_peptide: 1..61
experiment: experimental evidence, no additional details recorded
note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (Q06645.1)
calculated_mol_wt: 6654
peptide sequence: 
MQTTKALLISPVLIRSCTRGLIRPVSASLLSRPEAPSKKPSCCSSPLQVARREFQTSVISR

mat_peptide: 62..136
product: ATP synthase F(0) complex subunit C1, mitochondrial
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM