LMPD Database

LMP012932

Record overview

LMPD ID	LMP012932
Gene ID	171082
Species	Macaca mulata (Rhesus monkey)
Gene Name	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Gene Symbol	Atp5g2
Alternate names	ATP synthase F(0) complex subunit C2, mitochondrial; ATPase protein 9; ATPase subunit c; ATP synthase proteolipid P2; ATP synthase lipid-binding protein, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2;
Chromosome	7
Map Location	7q36
Summary	component of mitochondrial ATPase; displays increased expression in pancreas after alcohol consumption [RGD, Feb 2006]
Orthologs	View orthologs and multiple alignments for Atp5g2

Proteins

ATP synthase F(0) complex subunit C2, mitochondrial precursor

Refseq ID:	NP_598240
Protein GI:	19424234
UniProt ID:	Q06646
mRNA ID:	NM_133556
Length:	141
RefSeq Status:

`MYACSKFVSTRSLIRSTSQLLSRPLSAVELKRPQMPTDEGLSCLAVRRPLTSLIPSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLII GYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM`


transit_peptide: 1..66
experiment: experimental evidence, no additional details recorded
note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (Q06646.1)
calculated_mol_wt: 7328
peptide sequence: 
MYACSKFVSTRSLIRSTSQLLSRPLSAVELKRPQMPTDEGLSCLAVRRPLTSLIPSRSFQTSAISR

mat_peptide: 67..141
product: ATP synthase F(0) complex subunit C2, mitochondrial
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (Q06646.1)
calculated_mol_wt: 7608
peptide sequence: 
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM