Gene/Proteome Database (LMPD)

LMPD ID
LMP000023
Gene ID
3294
Species
Homo sapiens (Human)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 2
Gene Symbol
HSD17B2
Synonyms
EDH17B2; HSD17; SDR9C2
Alternate Names
estradiol 17-beta-dehydrogenase 2; E2DH; 20-alpha-HSD; 17-beta-HSD 2; testosterone 17-beta-dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase type 2; microsomal 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 9C, member 2
Chromosome
16
Map Location
16q24.1-q24.2
EC Number
1.1.1.62

Proteins

estradiol 17-beta-dehydrogenase 2
Refseq ID NP_002144
Protein GI 4504503
UniProt ID P37059
mRNA ID NM_002153
Length 387
RefSeq Status VALIDATED
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT

Gene Information

Entrez Gene ID
3294
Gene Name
hydroxysteroid (17-beta) dehydrogenase 2
Gene Symbol
HSD17B2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:ProtInc C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0047006 TAS:BHF-UCL F 17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity
GO:0004303 IDA:UniProtKB F estradiol 17-beta-dehydrogenase activity
GO:0047035 IDA:UniProtKB F testosterone dehydrogenase (NAD+) activity
GO:0001701 IEA:Ensembl P in utero embryonic development
GO:0001890 IEA:Ensembl P placenta development
GO:0032526 IDA:BHF-UCL P response to retinoic acid
GO:0006694 IEA:UniProtKB-KW P steroid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04913 Ovarian steroidogenesis
ko04913 Ovarian steroidogenesis
hsa00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid (17-beta) dehydrogenase 2
Protein Entry
DHB2_HUMAN
UniProt ID
P37059
Species
Human

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=0.21 uM for estradiol ; KM=0.39 uM for testosterone ; KM=0.31 uM for dihydrotestosterone ; KM=0.71 uM for 20-alpha-dihydroprogesterone ; KM=0.78 uM for estrone ; KM=2.63 uM for androstenedione ; Vmax=38 nmol/min/mg enzyme with estradiol as substrate ; Vmax=45 nmol/min/mg enzyme with testosterone as substrate ; Vmax=38 nmol/min/mg enzyme with dihydrotestosterone as substrate ; Vmax=5.6 nmol/min/mg enzyme with 20-alpha-dihydroprogesterone as substrate ; Vmax=6.6 nmol/min/mg enzyme with estrone as substrate ; Vmax=11.5 nmol/min/mg enzyme with androstenedione as substrate ;
Catalytic Activity 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H.
Catalytic Activity Testosterone + NAD(+) = androstenedione + NADH.
Function Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Subcellular Location Membrane ; Single-pass type II membrane protein .
Web Resource Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/hsd17b2/";

Identical and Related Proteins

Unique RefSeq proteins for LMP000023 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4504503 RefSeq NP_002144 387 estradiol 17-beta-dehydrogenase 2

Identical Sequences to LMP000023 proteins

Reference Database Accession Length Protein Name
GI:4504503 DBBJ BAG35931.1 387 unnamed protein product [Homo sapiens]
GI:4504503 GenBank ACM97385.1 387 Sequence 277 from patent US 7473531
GI:4504503 GenBank ADR87098.1 387 Sequence 370 from patent US 7740664
GI:4504503 GenBank AEK13653.1 387 Sequence 65 from patent US 7972785
GI:4504503 GenBank AHE02238.1 387 Sequence 60592 from patent US 8586006
GI:4504503 GenBank AIC48985.1 387 HSD17B2, partial [synthetic construct]

Related Sequences to LMP000023 proteins

Reference Database Accession Length Protein Name
GI:4504503 DBBJ BAD96721.1 387 hydroxysteroid (17-beta) dehydrogenase 2 variant, partial [Homo sapiens]
GI:4504503 GenBank AAV38556.1 388 hydroxysteroid (17-beta) dehydrogenase 2, partial [synthetic construct]
GI:4504503 GenBank AAX43135.1 388 hydroxysteroid (17-beta) dehydrogenase 2, partial [synthetic construct]
GI:4504503 RefSeq XP_511130.2 387 PREDICTED: estradiol 17-beta-dehydrogenase 2 [Pan troglodytes]
GI:4504503 RefSeq XP_003820931.1 387 PREDICTED: estradiol 17-beta-dehydrogenase 2 [Pan paniscus]
GI:4504503 RefSeq XP_009429575.1 387 PREDICTED: estradiol 17-beta-dehydrogenase 2 [Pan troglodytes]