Gene/Proteome Database (LMPD)

LMPD ID
LMP000039
Gene ID
9331
Species
Homo sapiens (Human)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
Gene Symbol
B4GALT6
Synonyms
B4Gal-T6; beta4Gal-T6
Alternate Names
beta-1,4-galactosyltransferase 6; beta4GalT-VI; beta-1,4-GalTase 6; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6; UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6
Chromosome
18
Map Location
18q11
EC Number
2.4.1.-
Summary
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene is a lactosylceramide synthase important for glycolipid biosynthesis. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for B4GALT6

Proteins

beta-1,4-galactosyltransferase 6
Refseq ID NP_004766
Protein GI 190570165
UniProt ID Q9UBX8
mRNA ID NM_004775
Length 382
RefSeq Status REVIEWED
MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY

Gene Information

Entrez Gene ID
9331
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
Gene Symbol
B4GALT6
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 TAS:Reactome C Golgi membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008378 TAS:ProtInc F galactosyltransferase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0005975 TAS:Reactome P carbohydrate metabolic process
GO:0044267 TAS:Reactome P cellular protein metabolic process
GO:0030203 TAS:Reactome P glycosaminoglycan metabolic process
GO:0018146 TAS:Reactome P keratan sulfate biosynthetic process
GO:0042339 TAS:Reactome P keratan sulfate metabolic process
GO:0043687 TAS:Reactome P post-translational protein modification
GO:0018279 TAS:Reactome P protein N-linked glycosylation via asparagine
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00600 Sphingolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_121120 Keratan sulfate biosynthesis
REACT_25085 N-Glycan antennae elongation

Domain Information

InterPro Annotations

Accession Description
IPR003859 Beta-1,4-galactosyltransferase
IPR027791 Galactosyltransferase, C-terminal
IPR027995 Galactosyltransferase, N-terminal
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
Protein Entry
B4GT6_HUMAN
UniProt ID
Q9UBX8
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9UBX8-1; Sequence=Displayed; Name=2; IsoId=Q9UBX8-2; Sequence=VSP_056554; Note=No experimental confirmation available.;
Biophysicochemical Properties Kinetic parameters: KM=3 uM for glucosylceramide ; KM=0.5 uM for UDP-galactose ; Vmax=0.06 nmol/h/mg enzyme toward glucosylceramide ; Vmax=86 nmol/h/mg enzyme toward UDP-galactose ;
Catalytic Activity UDP-alpha-D-galactose + beta-D-glucosyl- (1<->1)-ceramide = UDP + beta-D-galactosyl-(1->4)-beta-D-glucosyl- (1<->1)-ceramide.
Catalytic Activity UDP-galactose + glucosylceramide = UDP + lactosylceramide.
Cofactor Name=Mn(2+); Xref=ChEBI
Enzyme Regulation Inhibited by EDTA.
Function Required for the biosynthesis of glycosphingolipids.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 7 family.
Subcellular Location Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Trans cisternae of Golgi stack.
Tissue Specificity High expression in brain and adrenal gland, lower in liver, lung, colon and peripheral white blood cells.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=Beta-1,4-galactosyltransferase 6; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_441";
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=B4GALT6";

Identical and Related Proteins

Unique RefSeq proteins for LMP000039 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
190570165 RefSeq NP_004766 382 beta-1,4-galactosyltransferase 6

Identical Sequences to LMP000039 proteins

Reference Database Accession Length Protein Name
GI:190570165 GenBank AAH74884.1 382 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 [Homo sapiens]
GI:190570165 GenBank EAX01267.1 382 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6, isoform CRA_a [Homo sapiens]
GI:190570165 GenBank ABN36004.1 382 Sequence 6 from patent US 7169751
GI:190570165 GenBank ABW44299.1 382 Sequence 112 from patent US 7258971
GI:190570165 RefSeq XP_002828189.1 382 PREDICTED: beta-1,4-galactosyltransferase 6 isoform X1 [Pongo abelii]
GI:190570165 RefSeq XP_004059334.1 382 PREDICTED: beta-1,4-galactosyltransferase 6 isoform 1 [Gorilla gorilla gorilla]

Related Sequences to LMP000039 proteins

Reference Database Accession Length Protein Name
GI:190570165 GenBank AAC39737.1 382 beta-1,4-galactosyltransferase [Homo sapiens]
GI:190570165 GenBank ACM81052.1 382 Sequence 6550 from patent US 6812339
GI:190570165 GenBank ACM82732.1 404 Sequence 8230 from patent US 6812339
GI:190570165 GenBank JAA41959.1 382 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 [Pan troglodytes]
GI:190570165 GenBank AHD73728.1 382 Sequence 12186 from patent US 8586006
GI:190570165 RefSeq XP_003830302.1 382 PREDICTED: beta-1,4-galactosyltransferase 6 isoform X1 [Pan paniscus]