Gene/Proteome Database (LMPD)
LMPD ID
LMP000052
Gene ID
Species
Homo sapiens (Human)
Gene Name
methylsterol monooxygenase 1
Gene Symbol
Synonyms
DESP4; ERG25; SC4MOL
Alternate Names
methylsterol monooxygenase 1; C-4 methyl sterol; C-4 methylsterol oxidase
Chromosome
4
Map Location
4q32-q34
EC Number
1.14.13.72
Summary
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| methylsterol monooxygenase 1 isoform 1 | |
|---|---|
| Refseq ID | NP_006736 |
| Protein GI | 5803157 |
| UniProt ID | Q15800 |
| mRNA ID | NM_006745 |
| Length | 293 |
| RefSeq Status | REVIEWED |
| MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEALYFLFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFTEYFNIPYDWERMPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE | |
| methylsterol monooxygenase 1 isoform 2 | |
|---|---|
| Refseq ID | NP_001017369 |
| Protein GI | 62865628 |
| UniProt ID | Q15800 |
| mRNA ID | NM_001017369 |
| Length | 162 |
| RefSeq Status | REVIEWED |
| MPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | TAS:ProtInc | C | endoplasmic reticulum |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | TAS:ProtInc | C | integral component of membrane |
| GO:0005886 | TAS:ProtInc | C | plasma membrane |
| GO:0000254 | TAS:ProtInc | F | C-4 methylsterol oxidase activity |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0006695 | TAS:Reactome | P | cholesterol biosynthetic process |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0006631 | TAS:ProtInc | P | fatty acid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0008202 | TAS:ProtInc | P | steroid metabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-6074 | zymosterol biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_9405 | Cholesterol biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q15800-1; Sequence=Displayed; Name=2; IsoId=Q15800-2; Sequence=VSP_044585; |
| Catalytic Activity | 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-carbaldehyde + NAD(P)H + O(2) = 3-beta-hydroxy-4- beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)(+) + H(2)O. |
| Catalytic Activity | 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)(+) + H(2)O. |
| Catalytic Activity | 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 3-beta-hydroxy-4-beta- methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)(+) + 2 H(2)O. |
| Cofactor | Name=Fe cation; Xref=ChEBI |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
| Pathway | Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 3/6. |
| Similarity | Belongs to the sterol desaturase family. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP000052 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 5803157 | RefSeq | NP_006736 | 293 | methylsterol monooxygenase 1 isoform 1 |
| 62865628 | RefSeq | NP_001017369 | 162 | methylsterol monooxygenase 1 isoform 2 |
Identical Sequences to LMP000052 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62865628 | DBBJ | BAH12066.1 | 162 | unnamed protein product [Homo sapiens] |
| GI:62865628 | GenBank | AHD72302.1 | 162 | Sequence 7800 from patent US 8586006 |
| GI:5803157 | GenBank | AHD72303.1 | 293 | Sequence 7801 from patent US 8586006 |
| GI:62865628 | RefSeq | XP_001139385.2 | 162 | PREDICTED: methylsterol monooxygenase 1 isoform X2 [Pan troglodytes] |
| GI:62865628 | RefSeq | XP_003310611.1 | 162 | PREDICTED: methylsterol monooxygenase 1 isoform X3 [Pan troglodytes] |
| GI:62865628 | RefSeq | XP_003805046.1 | 162 | PREDICTED: methylsterol monooxygenase 1 isoform X3 [Pan paniscus] |
| GI:5803157 | RefSeq | XP_004040640.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform 1 [Gorilla gorilla gorilla] |
| GI:62865628 | RefSeq | XP_004040641.1 | 162 | PREDICTED: methylsterol monooxygenase 1 isoform 2 [Gorilla gorilla gorilla] |
| GI:5803157 | RefSeq | XP_005263233.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X1 [Homo sapiens] |
| GI:5803157 | RefSeq | XP_008964349.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X1 [Pan paniscus] |
| GI:5803157 | RefSeq | XP_009238699.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X1 [Pongo abelii] |
| GI:5803157 | RefSeq | XP_009238700.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X1 [Pongo abelii] |
Related Sequences to LMP000052 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62865628 | DBBJ | BAF85107.1 | 293 | unnamed protein product [Homo sapiens] |
| GI:62865628 | EMBL | CAH93092.1 | 293 | hypothetical protein [Pongo abelii] |
| GI:62865628 | GenBank | EAX04820.1 | 293 | sterol-C4-methyl oxidase-like, isoform CRA_a [Homo sapiens] |
| GI:62865628 | GenBank | EAX04821.1 | 293 | sterol-C4-methyl oxidase-like, isoform CRA_a [Homo sapiens] |
| GI:5803157 | GenBank | AIC55087.1 | 293 | MSMO1, partial [synthetic construct] |
| GI:62865628 | RefSeq | NP_006736.1 | 293 | methylsterol monooxygenase 1 isoform 1 [Homo sapiens] |
| GI:5803157 | RefSeq | XP_003257982.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform 1 [Nomascus leucogenys] |
| GI:62865628 | RefSeq | XP_003310610.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X1 [Pan troglodytes] |
| GI:5803157 | RefSeq | XP_007998396.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X1 [Chlorocebus sabaeus] |
| GI:5803157 | RefSeq | XP_010362876.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X1 [Rhinopithecus roxellana] |
| GI:5803157 | RefSeq | XP_010362877.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X1 [Rhinopithecus roxellana] |
| GI:5803157 | RefSeq | XP_010362878.1 | 293 | PREDICTED: methylsterol monooxygenase 1 isoform X1 [Rhinopithecus roxellana] |