Gene/Proteome Database (LMPD)

LMPD ID
LMP000054
Gene ID
6646
Species
Homo sapiens (Human)
Gene Name
sterol O-acyltransferase 1
Gene Symbol
SOAT1
Synonyms
ACACT; ACAT; ACAT-1; ACAT1; SOAT; STAT
Alternate Names
sterol O-acyltransferase 1; acyl-coenzyme A:cholesterol acyltransferase 1; sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1
Chromosome
1
Map Location
1q25
EC Number
2.3.1.26
Summary
The protein encoded by this gene belongs to the acyltransferase family. It is located in the endoplasmic reticulum, and catalyzes the formation of fatty acid-cholesterol esters. This gene has been implicated in the formation of beta-amyloid and atherosclerotic plaques by controlling the equilibrium between free cholesterol and cytoplasmic cholesteryl esters. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2011]
Orthologs
View orthologs and multiple alignments for SOAT1

Proteins

sterol O-acyltransferase 1 isoform 1
Refseq ID NP_003092
Protein GI 49533617
UniProt ID P35610
mRNA ID NM_003101
Length 550
RefSeq Status REVIEWED
MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVF
sterol O-acyltransferase 1 isoform 2
Refseq ID NP_001239440
Protein GI 357430782
UniProt ID P35610
mRNA ID NM_001252511
Length 492
RefSeq Status REVIEWED
MELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVF
sterol O-acyltransferase 1 isoform 3
Refseq ID NP_001239441
Protein GI 357430784
UniProt ID P35610
mRNA ID NM_001252512
Length 485
RefSeq Status REVIEWED
MKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVF

Gene Information

Entrez Gene ID
6646
Gene Name
sterol O-acyltransferase 1
Gene Symbol
SOAT1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:BHF-UCL C endoplasmic reticulum
GO:0005789 IDA:BHF-UCL C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 IDA:MGI C membrane
GO:0034736 IDA:BHF-UCL F cholesterol O-acyltransferase activity
GO:0015485 IDA:BHF-UCL F cholesterol binding
GO:0000062 IDA:BHF-UCL F fatty-acyl-CoA binding
GO:0004772 IMP:BHF-UCL F sterol O-acyltransferase activity
GO:0033344 IMP:BHF-UCL P cholesterol efflux
GO:0034435 IDA:BHF-UCL P cholesterol esterification
GO:0042632 TAS:BHF-UCL P cholesterol homeostasis
GO:0008203 IDA:BHF-UCL P cholesterol metabolic process
GO:0010878 IMP:BHF-UCL P cholesterol storage
GO:0010742 IMP:BHF-UCL P macrophage derived foam cell differentiation
GO:0042986 IMP:BHF-UCL P positive regulation of amyloid precursor protein biosynthetic process
GO:0034379 IMP:BHF-UCL P very-low-density lipoprotein particle assembly

KEGG Pathway Links

KEGG Pathway ID Description
hsa00100 Steroid biosynthesis
ko00100 Steroid biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR004299 Membrane bound O-acyl transferase, MBOAT
IPR014371 Sterol O-acyltransferase, ACAT/DAG/ARE types

UniProt Annotations

Entry Information

Gene Name
sterol O-acyltransferase 1
Protein Entry
SOAT1_HUMAN
UniProt ID
P35610
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P35610-1; Sequence=Displayed; Name=2; IsoId=P35610-2; Sequence=VSP_045331; Name=3; IsoId=P35610-3; Sequence=VSP_045330;
Catalytic Activity Acyl-CoA + cholesterol = CoA + cholesterol ester.
Function Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase.
Induction Highly activated by the presence of cholesterol.
Interaction Q9Y5Z9:UBIAD1; NbExp=3; IntAct=EBI-6621997, EBI-2819725;
Similarity Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Subunit May form homo- or heterodimers. Interacts with UBIAD1.

Identical and Related Proteins

Unique RefSeq proteins for LMP000054 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
49533617 RefSeq NP_003092 550 sterol O-acyltransferase 1 isoform 1
357430782 RefSeq NP_001239440 492 sterol O-acyltransferase 1 isoform 2
357430784 RefSeq NP_001239441 485 sterol O-acyltransferase 1 isoform 3

Identical Sequences to LMP000054 proteins

Reference Database Accession Length Protein Name
GI:357430782 DBBJ BAF83348.1 492 unnamed protein product [Homo sapiens]
GI:357430784 DBBJ BAG62257.1 485 unnamed protein product [Homo sapiens]
GI:357430784 GenBank EAW91043.1 485 sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1, isoform CRA_a [Homo sapiens]
GI:49533617 GenBank JAA08173.1 550 sterol O-acyltransferase 1 [Pan troglodytes]
GI:49533617 GenBank JAA26481.1 550 sterol O-acyltransferase 1 [Pan troglodytes]
GI:49533617 GenBank JAA41814.1 550 sterol O-acyltransferase 1 [Pan troglodytes]
GI:49533617 GenBank AHD75002.1 550 Sequence 15706 from patent US 8586006
GI:49533617 GenBank AIC49768.1 550 SOAT1, partial [synthetic construct]
GI:49533617 RefSeq XP_003824754.1 550 PREDICTED: sterol O-acyltransferase 1 [Pan paniscus]
GI:357430784 RefSeq XP_004028024.1 485 PREDICTED: sterol O-acyltransferase 1 isoform 1 [Gorilla gorilla gorilla]
GI:357430784 RefSeq XP_004028025.1 485 PREDICTED: sterol O-acyltransferase 1 isoform 2 [Gorilla gorilla gorilla]

Related Sequences to LMP000054 proteins

Reference Database Accession Length Protein Name
GI:49533617 GenBank AAA95660.1 550 Sequence 4 from patent US 5484727
GI:49533617 GenBank AAC37532.2 550 acyl-coenzyme A: cholesterol acyltransferase [Homo sapiens]
GI:49533617 GenBank AAE15377.1 550 Sequence 4 from patent US 5834283
GI:49533617 GenBank AAE31894.1 550 Sequence 4 from patent US 5968749
GI:49533617 GenBank ABM82733.1 550 sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1 [synthetic construct]
GI:357430784 GenBank ABM85917.1 550 sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1, partial [synthetic construct]
GI:357430782 GenBank ABM85917.1 550 sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1, partial [synthetic construct]
GI:357430784 GenBank JAA08173.1 550 sterol O-acyltransferase 1 [Pan troglodytes]
GI:357430782 GenBank JAA08173.1 550 sterol O-acyltransferase 1 [Pan troglodytes]
GI:357430782 GenBank JAA26481.1 550 sterol O-acyltransferase 1 [Pan troglodytes]
GI:357430784 GenBank JAA26481.1 550 sterol O-acyltransferase 1 [Pan troglodytes]
GI:357430782 GenBank JAA41814.1 550 sterol O-acyltransferase 1 [Pan troglodytes]
GI:357430784 GenBank JAA41814.1 550 sterol O-acyltransferase 1 [Pan troglodytes]
GI:49533617 PRF - 550 acyl-CoA/cholesterol acyltransferase [Homo sapiens]
GI:357430784 RefSeq XP_003824754.1 550 PREDICTED: sterol O-acyltransferase 1 [Pan paniscus]
GI:357430782 RefSeq XP_003824754.1 550 PREDICTED: sterol O-acyltransferase 1 [Pan paniscus]
GI:357430782 SwissProt P35610.3 550 RecName: Full=Sterol O-acyltransferase 1; AltName: Full=Acyl-coenzyme A:cholesterol acyltransferase 1; Short=ACAT-1; AltName: Full=Cholesterol acyltransferase 1 [Homo sapiens]
GI:357430784 SwissProt P35610.3 550 RecName: Full=Sterol O-acyltransferase 1; AltName: Full=Acyl-coenzyme A:cholesterol acyltransferase 1; Short=ACAT-1; AltName: Full=Cholesterol acyltransferase 1 [Homo sapiens]