Gene/Proteome Database (LMPD)
LMPD ID
LMP000093
Gene ID
Species
Mus musculus (Mouse)
Gene Name
sterol O-acyltransferase 1
Gene Symbol
Synonyms
8430426K15Rik; ACAT-1; AW550831; Acact; ald; hid
Alternate Names
sterol O-acyltransferase 1; cholesterol acyltransferase 1; adrenocortical lipid depletion; acyl coenzyme A:cholesterol acyltransferase 1; acyl-coenzyme A:cholesterol acyltransferase 1
Chromosome
1
Map Location
1 G3|1 67.71 cM
EC Number
2.3.1.26
Proteins
| sterol O-acyltransferase 1 | |
|---|---|
| Refseq ID | NP_033256 |
| Protein GI | 84619697 |
| UniProt ID | Q61263 |
| mRNA ID | NM_009230 |
| Length | 540 |
| RefSeq Status | VALIDATED |
| MSLRNRLSKSGENPEQDEAQKNFMDTYRNGHITMKQLIAKKRLLAAEAEELKPLFMKEVGCHFDDFVTNLIEKSASLDNGGCALTTFSILEEMKKNHRAKDLRAPPEQGKIFISRQSLLDELFEVDHIRTIYHMFIALLILFVLSTIVVDYIDEGRLVLEFNLLAYAFGKFPTVIWTWWAMFLSTLSIPYFLFQRWAHGYSKSSHPLIYSLVHGLLFLVFQLGVLGFVPTYVVLAYTLPPASRFILILEQIRLIMKAHSFVRENIPRVLNAAKEKSSKDPLPTVNQYLYFLFAPTLIYRDNYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVLILFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYVYKDLLWFFSKRFKSAAMLAVFALSAVVHEYALAICLSYFYPVLFVLFMFFGMAFNFIVNDSRKRPIWNIMVWASLFLGYGLILCFYSQEWYARQHCPLKNPTFLDYVRPRTWTCRYVF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0034736 | IEA:UniProtKB-EC | F | cholesterol O-acyltransferase activity |
| GO:0004772 | IDA:MGI | F | sterol O-acyltransferase activity |
| GO:0008203 | IDA:MGI | P | cholesterol metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + cholesterol = CoA + cholesterol ester. |
| Function | Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. |
| Similarity | Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein {ECO:0000269|PubMed:11071899}. |
| Subunit | May form homo- or heterodimers. Interacts with UBIAD1 (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000093 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 84619697 | RefSeq | NP_033256 | 540 | sterol O-acyltransferase 1 |
Identical Sequences to LMP000093 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:84619697 | DBBJ | BAE35047.1 | 540 | unnamed protein product [Mus musculus] |
| GI:84619697 | DBBJ | BAE35158.1 | 540 | unnamed protein product [Mus musculus] |
| GI:84619697 | DBBJ | BAE25081.1 | 540 | unnamed protein product [Mus musculus] |
| GI:84619697 | DBBJ | BAE35563.1 | 540 | unnamed protein product [Mus musculus] |
| GI:84619697 | GenBank | AAH83092.1 | 540 | Sterol O-acyltransferase 1 [Mus musculus] |
| GI:84619697 | SwissProt | Q61263.2 | 540 | RecName: Full=Sterol O-acyltransferase 1; AltName: Full=Acyl-coenzyme A:cholesterol acyltransferase 1; Short=ACAT-1; AltName: Full=Cholesterol acyltransferase 1 [Mus musculus] |
Related Sequences to LMP000093 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:84619697 | GenBank | AAC42075.1 | 540 | acyl-coenzyme A: cholesterol acyltransferase [Mus musculus] |
| GI:84619697 | GenBank | ABI81497.1 | 540 | sterol O-acyltransferase 1 [Mus musculus] |
| GI:84619697 | GenBank | EDM09484.1 | 545 | sterol O-acyltransferase 1, isoform CRA_a [Rattus norvegicus] |
| GI:84619697 | PRF | - | 540 | acyl-CoA/cholesterol acyltransferase [Mus musculus] |
| GI:84619697 | RefSeq | XP_005363965.1 | 546 | PREDICTED: sterol O-acyltransferase 1 [Microtus ochrogaster] |
| GI:84619697 | RefSeq | XP_006973857.1 | 546 | PREDICTED: sterol O-acyltransferase 1 [Peromyscus maniculatus bairdii] |