Gene/Proteome Database (LMPD)

LMPD ID
LMP000139
Gene ID
11807
Species
Mus musculus (Mouse)
Gene Name
apolipoprotein A-II
Gene Symbol
Apoa2
Synonyms
Alp-2; ApoA-II; ApoAII; Apoa-2; Hdl-1
Alternate Names
apolipoprotein A-II; apo-AII; apolipoprotein A2
Chromosome
1
Map Location
1 H3|1 79.22 cM

Proteins

apolipoprotein A-II precursor
Refseq ID NP_038502
Protein GI 157951676
UniProt ID P09813
mRNA ID NM_013474
Length 102
RefSeq Status VALIDATED
MKLLAMVALLVTICSLEGALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK
sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1905 peptide sequence: MKLLAMVALLVTICSLEG mat_peptide: 24..102 product: Apolipoprotein A-II experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P09813.2) calculated_mol_wt: 8854 peptide sequence: QADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK

Gene Information

Entrez Gene ID
11807
Gene Name
apolipoprotein A-II
Gene Symbol
Apoa2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0072562 IEA:Ensembl C blood microparticle
GO:0042627 IEA:Ensembl C chylomicron
GO:0005829 TAS:Reactome C cytosol
GO:0005576 TAS:Reactome C extracellular region
GO:0005615 IDA:MGI C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0034366 IEA:Ensembl C spherical high-density lipoprotein particle
GO:0034361 IEA:Ensembl C very-low-density lipoprotein particle
GO:0015485 IEA:Ensembl F cholesterol binding
GO:0017127 IEA:Ensembl F cholesterol transporter activity
GO:0008035 IMP:MGI F high-density lipoprotein particle binding
GO:0055102 IEA:Ensembl F lipase inhibitor activity
GO:0031210 IEA:Ensembl F phosphatidylcholine binding
GO:0060228 IEA:Ensembl F phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0046982 ISS:UniProtKB F protein heterodimerization activity
GO:0002526 IEA:Ensembl P acute inflammatory response
GO:0015759 NAS:UniProtKB P beta-glucoside transport
GO:0033344 IEA:Ensembl P cholesterol efflux
GO:0042632 IDA:MGI P cholesterol homeostasis
GO:0008203 IMP:MGI P cholesterol metabolic process
GO:0046340 IEA:Ensembl P diacylglycerol catabolic process
GO:0006631 NAS:UniProtKB P fatty acid metabolic process
GO:0034380 IEA:Ensembl P high-density lipoprotein particle assembly
GO:0034384 IEA:Ensembl P high-density lipoprotein particle clearance
GO:0034375 IEA:Ensembl P high-density lipoprotein particle remodeling
GO:0006869 IMP:MGI P lipid transport
GO:0042157 IDA:MGI P lipoprotein metabolic process
GO:0034374 IEA:Ensembl P low-density lipoprotein particle remodeling
GO:0060621 IEA:Ensembl P negative regulation of cholesterol import
GO:0060695 IEA:Ensembl P negative regulation of cholesterol transporter activity
GO:0002740 IEA:Ensembl P negative regulation of cytokine secretion involved in immune response
GO:0060192 IMP:MGI P negative regulation of lipase activity
GO:0050995 IEA:Ensembl P negative regulation of lipid catabolic process
GO:0010903 IEA:Ensembl P negative regulation of very-low-density lipoprotein particle remodeling
GO:0031100 IEA:Ensembl P organ regeneration
GO:0018206 IEA:Ensembl P peptidyl-methionine modification
GO:0006656 IEA:Ensembl P phosphatidylcholine biosynthetic process
GO:0009395 IEA:Ensembl P phospholipid catabolic process
GO:0033700 IEA:Ensembl P phospholipid efflux
GO:0010873 IEA:Ensembl P positive regulation of cholesterol esterification
GO:0045416 ISS:UniProtKB P positive regulation of interleukin-8 biosynthetic process
GO:0050996 IEA:Ensembl P positive regulation of lipid catabolic process
GO:0006457 IEA:Ensembl P protein folding
GO:0018158 IEA:Ensembl P protein oxidation
GO:0030300 IMP:MGI P regulation of intestinal cholesterol absorption
GO:0031647 IEA:Ensembl P regulation of protein stability
GO:0042493 IEA:Ensembl P response to drug
GO:0043627 IEA:Ensembl P response to estrogen
GO:0051384 IEA:Ensembl P response to glucocorticoid
GO:0009749 IEA:Ensembl P response to glucose
GO:0043691 IEA:Ensembl P reverse cholesterol transport
GO:0034370 IEA:Ensembl P triglyceride-rich lipoprotein particle remodeling

KEGG Pathway Links

KEGG Pathway ID Description
mmu03320 PPAR signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5893389 Chylomicron-mediated lipid transport
5893843 PPARA activates gene expression

Domain Information

InterPro Annotations

Accession Description
IPR006801 Apolipoprotein A-II (ApoA-II)

UniProt Annotations

Entry Information

Gene Name
apolipoprotein A-II
Protein Entry
APOA2_MOUSE
UniProt ID
P09813
Species
Mouse

Comments

Comment Type Description
Disease Note=Defects in Apoa2 are the cause of senescence accelerated mouse (SAM), the senile amyloid is a mutated apolipoprotein A-II.
Function May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.
Mass Spectrometry Mass=8709.2; Mass_error=0.071; Method=Electrospray; Range=24-102; Note=Strain C57BL/6. Without methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491};
Mass Spectrometry Mass=8719.5; Method=Electrospray; Range=24-102; Note=Strain BALB/c. Without methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491};
Mass Spectrometry Mass=8725.3; Mass_error=0.283; Method=Electrospray; Range=24-102; Note=Strain C57BL/6. With 1 methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491};
Mass Spectrometry Mass=8735.2; Method=Electrospray; Range=24-102; Note=Strain BALB/c. With 1 methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491};
Mass Spectrometry Mass=8742; Method=Electrospray; Range=24-102; Note=Strain C57BL/6. With 2 methionine sulfoxides.; Evidence={ECO:0000269|PubMed:16876491};
Mass Spectrometry Mass=9294; Mass_error=0.707; Method=Electrospray; Range=19-102; Note=Strain C57BL/6. Without methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491};
Mass Spectrometry Mass=9304; Method=Electrospray; Range=19-102; Note=Strain BALB/c. Without methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491};
Miscellaneous The apo A-II stoichiometry in HDL molecules varies among inbred mice strains, because of structural polymorphisms affecting the apo A-II gene, which influence its translational efficiency.
Miscellaneous The sequence presented here is that of strain BALB/c and C3H/HeJ.
Ptm Phosphorylation sites are present in the extracellular medium. {ECO:0000250}.
Similarity Belongs to the apolipoprotein A2 family. {ECO:0000305}.
Subcellular Location Secreted.
Subunit Monomer. Interacts with APOA1BP and NDRG1 (By similarity). {ECO:0000250}.
Tissue Specificity Plasma.

Identical and Related Proteins

Unique RefSeq proteins for LMP000139 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157951676 RefSeq NP_038502 102 apolipoprotein A-II precursor

Identical Sequences to LMP000139 proteins

Reference Database Accession Length Protein Name
GI:157951676 GenBank EDL39118.1 102 apolipoprotein A-II, isoform CRA_a [Mus musculus]
GI:157951676 GenBank EDL39119.1 102 apolipoprotein A-II, isoform CRA_a [Mus musculus]
GI:157951676 GenBank EDL39120.1 102 apolipoprotein A-II, isoform CRA_a [Mus musculus]
GI:157951676 GenBank EDL39121.1 102 apolipoprotein A-II, isoform CRA_a [Mus musculus]
GI:157951676 RefSeq XP_006496688.1 102 PREDICTED: apolipoprotein A-II isoform X1 [Mus musculus]
GI:157951676 SwissProt P09813.2 102 RecName: Full=Apolipoprotein A-II; Short=Apo-AII; Short=ApoA-II; AltName: Full=Apolipoprotein A2; Contains: RecName: Full=Proapolipoprotein A-II; Short=ProapoA-II; Flags: Precursor [Mus musculus]

Related Sequences to LMP000139 proteins

Reference Database Accession Length Protein Name
GI:157951676 EMBL CAA27731.1 102 unnamed protein product [Mus musculus]
GI:157951676 EMBL CAA44616.1 102 apolipoprotein A-II [Mus musculus]
GI:157951676 GenBank AAA37250.1 102 apolipoprotein A-II [Mus musculus domesticus]
GI:157951676 GenBank AAB35391.1 102 APOAII [Mus musculus]
GI:157951676 GenBank AAH31786.1 102 Apolipoprotein A-II [Mus musculus]
GI:157951676 GenBank ABV02576.1 102 apolipoprotein A-II [Mus musculus]