Gene/Proteome Database (LMPD)
LMPD ID
LMP000140
Gene ID
Species
Homo sapiens (Human)
Gene Name
hydroxysteroid (11-beta) dehydrogenase 2
Gene Symbol
Synonyms
AME; AME1; HSD11K; HSD2; SDR9C3
Alternate Names
corticosteroid 11-beta-dehydrogenase isozyme 2; 11-DH2; 11-beta-HSD2; -HSD11 type II; 11-beta-hydroxysteroid dehydrogenase type 2; 11-beta-hydroxysteroid dehydrogenase type II; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 9C member 3
Chromosome
16
Map Location
16q22
EC Number
1.1.1.-
Summary
There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension. [provided by RefSeq, Feb 2010]
Orthologs
Proteins
| corticosteroid 11-beta-dehydrogenase isozyme 2 | |
|---|---|
| Refseq ID | NP_000187 |
| Protein GI | 119392083 |
| UniProt ID | P80365 |
| mRNA ID | NM_000196 |
| Length | 405 |
| RefSeq Status | REVIEWED |
| MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (11-beta) dehydrogenase 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0003845 | IEA:Ensembl | F | 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity |
| GO:0051287 | IEA:Ensembl | F | NAD binding |
| GO:0005496 | IEA:Ensembl | F | steroid binding |
| GO:0007565 | IEA:Ensembl | P | female pregnancy |
| GO:0006704 | TAS:ProtInc | P | glucocorticoid biosynthetic process |
| GO:0002017 | IEA:Ensembl | P | regulation of blood volume by renal aldosterone |
| GO:0042493 | IEA:Ensembl | P | response to drug |
| GO:0032094 | IEA:Ensembl | P | response to food |
| GO:0051384 | IEA:Ensembl | P | response to glucocorticoid |
| GO:0001666 | IEA:Ensembl | P | response to hypoxia |
| GO:0032868 | IEA:Ensembl | P | response to insulin |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (11-beta) dehydrogenase 2
Protein Entry
DHI2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=26.1 nM for cortisol {ECO |
| Catalytic Activity | An 11-beta-hydroxysteroid + NAD(+) = an 11- oxosteroid + NADH. |
| Disease | Apparent mineralocorticoid excess (AME) [MIM |
| Enzyme Regulation | Inhibited by glycyrrhetinic acid (derived from liquorice), carbenoloxone and 11-alpha-OH-progesterone. |
| Function | Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. |
| Miscellaneous | Consumption of large amounts of liquorice can lead to apparent mineralocorticoid excess and hypertension. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Subcellular Location | Microsome . Endoplasmic reticulum . |
| Subunit | Interacts with ligand-free cytoplasmic NR3C2. |
| Tissue Specificity | Found in placenta, kidney, pancreas, prostate, ovary, small intestine and colon. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000140 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 119392083 | RefSeq | NP_000187 | 405 | corticosteroid 11-beta-dehydrogenase isozyme 2 |
Identical Sequences to LMP000140 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:119392083 | GenBank | AAC50356.1 | 405 | 11-beta-hydroxysteroid dehydrogenase type 2 [Homo sapiens] |
| GI:119392083 | GenBank | EAW83134.1 | 405 | hydroxysteroid (11-beta) dehydrogenase 2 [Homo sapiens] |
| GI:119392083 | GenBank | ABS29267.1 | 405 | hydroxysteroid (11-beta) dehydrogenase 2 [Homo sapiens] |
| GI:119392083 | GenBank | ACS13714.1 | 405 | corticosteroid 11-beta-dehydrogenase isozyme 2 [Homo sapiens] |
| GI:119392083 | PRF | - | 405 | 11beta-hydroxysteroid dehydrogenase:ISOTYPE=2 [Homo sapiens] |
| GI:119392083 | SwissProt | P80365.2 | 405 | RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme 2; AltName: Full=11-beta-hydroxysteroid dehydrogenase type 2; Short=11-DH2; Short=11-beta-HSD2; AltName: Full=11-beta-hydroxysteroid dehydrogenase type II; Short=-HSD11 type II; AltName: Full=NAD-dependent 11-beta-hydroxysteroid dehydrogenase; Short=11-beta-HSD [Homo sapiens] |
Related Sequences to LMP000140 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:119392083 | GenBank | AAA91969.1 | 405 | 11 beta-hydroxysteroid dehydrogenase type II [Homo sapiens] |
| GI:119392083 | GenBank | AAB48544.1 | 405 | 11 beta-hydroxysteroid dehydrogenase 2 [Homo sapiens] |
| GI:119392083 | GenBank | AAE30603.1 | 405 | Sequence 2 from patent US 5965372 |
| GI:119392083 | GenBank | AAH64536.1 | 405 | Hydroxysteroid (11-beta) dehydrogenase 2 [Homo sapiens] |
| GI:119392083 | RefSeq | XP_523393.2 | 405 | PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 2 [Pan troglodytes] |
| GI:119392083 | RefSeq | XP_004057864.1 | 405 | PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 2 [Gorilla gorilla gorilla] |