Gene/Proteome Database (LMPD)

LMPD ID
LMP000144
Gene ID
11812
Species
Mus musculus (Mouse)
Gene Name
apolipoprotein C-I
Gene Symbol
Apoc1
Synonyms
Apo-CIB; ApoC-IB; apo-CI; apoC-I
Alternate Names
apolipoprotein C-I; apolipoprotein C1
Chromosome
7
Map Location
7 A3|7 9.94 cM
Summary
This gene encodes a precursor plasma protein that is cleaved to yield a signal peptide and two alternatively processed mature peptides. The encoded protein, which is a component of chylomicrons, very low density lipoproteins and high density lipoproteins, transports lipids from the intestines to other locations in the body. This protein binds to free fatty acids preventing their uptake by cells. This protein is a cofactor for lecithin cholesterol acyltransferase, an enzyme that catalyzes the conversion of free cholesterol to cholesteryl esters. The encoded protein inhibits the activity of the cholesteryl ester transfer protein which promotes the exchange of neutral lipids between lipoproteins. In humans this gene is associated with risk of coronary artery disease and age-associated memory impairment. Mice lacking this gene demonstrate impaired memory. This gene is clustered with three other apolipoprotein genes on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
Orthologs
View orthologs and multiple alignments for Apoc1

Proteins

apolipoprotein C-I precursor
Refseq ID NP_001103479
Protein GI 158517825
UniProt ID P34928
mRNA ID NM_001110009
Length 88
RefSeq Status REVIEWED
MRLFIALPVLIVVVAMTLEGPAPAQAAPDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
apolipoprotein C-I precursor
Refseq ID NP_031495
Protein GI 6680704
UniProt ID P34928
mRNA ID NM_007469
Length 88
RefSeq Status REVIEWED
Protein sequence is identical to GI:158517825 (mRNA isoform)
sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2721 peptide sequence: MRLFIALPVLIVVVAMTLEGPAPAQA mat_peptide: 27..88 product: Apolipoprotein C-I experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P34928.1) calculated_mol_wt: 6993 peptide sequence: APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS mat_peptide: 29..88 product: Truncated apolipoprotein C-I experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P34928.1) calculated_mol_wt: 6825 peptide sequence: DLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2721 peptide sequence: MRLFIALPVLIVVVAMTLEGPAPAQA mat_peptide: 27..88 product: Apolipoprotein C-I experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P34928.1) calculated_mol_wt: 6993 peptide sequence: APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS mat_peptide: 29..88 product: Truncated apolipoprotein C-I experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P34928.1) calculated_mol_wt: 6825 peptide sequence: DLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS

Gene Information

Entrez Gene ID
11812
Gene Name
apolipoprotein C-I
Gene Symbol
Apoc1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0034364 IEA:Ensembl C high-density lipoprotein particle
GO:0034361 IEA:UniProtKB-KW C very-low-density lipoprotein particle
GO:0005504 IEA:Ensembl F fatty acid binding
GO:0004859 IEA:Ensembl F phospholipase inhibitor activity
GO:0033344 IEA:Ensembl P cholesterol efflux
GO:0008203 IMP:MGI P cholesterol metabolic process
GO:0034382 IEA:Ensembl P chylomicron remnant clearance
GO:0042157 IEA:InterPro P lipoprotein metabolic process
GO:0032375 IEA:Ensembl P negative regulation of cholesterol transport
GO:0045717 IEA:Ensembl P negative regulation of fatty acid biosynthetic process
GO:0051005 IEA:Ensembl P negative regulation of lipoprotein lipase activity
GO:0010900 IEA:Ensembl P negative regulation of phosphatidylcholine catabolic process
GO:0048261 IEA:Ensembl P negative regulation of receptor-mediated endocytosis
GO:0010916 IEA:Ensembl P negative regulation of very-low-density lipoprotein particle clearance
GO:0033700 IEA:Ensembl P phospholipid efflux
GO:0034369 IEA:Ensembl P plasma lipoprotein particle remodeling
GO:0006641 IMP:MGI P triglyceride metabolic process
GO:0034447 IEA:Ensembl P very-low-density lipoprotein particle clearance

Domain Information

InterPro Annotations

Accession Description
IPR006781 Apolipoprotein C-I

UniProt Annotations

Entry Information

Gene Name
apolipoprotein C-I
Protein Entry
APOC1_MOUSE
UniProt ID
P34928
Species
Mouse

Comments

Comment Type Description
Function Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein (By similarity). Binds free fatty acids and reduces their intracellular esterification. {ECO:0000250|UniProtKB:P02654, ECO:0000250|UniProtKB:P33047, ECO:0000269|PubMed:17339654}.
Mass Spectrometry Mass=6825.6; Mass_error=0.495; Method=Electrospray; Range=29-88; Note=Strain C57BL/6. Without methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491};
Mass Spectrometry Mass=6993; Mass_error=0.707; Method=Electrospray; Range=27-88; Note=Strain C57BL/6. Without methionine sulfoxide.; Evidence={ECO:0000269|PubMed:16876491};
Similarity Belongs to the apolipoprotein C1 family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000250|UniProtKB:P02654}.
Tissue Specificity Adult and fetal liver. {ECO:0000269|PubMed:8276416}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000144 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
158517825 RefSeq NP_001103479 88 apolipoprotein C-I precursor

Identical Sequences to LMP000144 proteins

Reference Database Accession Length Protein Name
GI:158517825 DBBJ BAB27566.1 88 unnamed protein product [Mus musculus]
GI:158517825 GenBank AAH19398.1 88 Apolipoprotein C-I [Mus musculus]
GI:158517825 GenBank AAH94638.1 88 Apolipoprotein C-I [Mus musculus]
GI:158517825 GenBank EDL23173.1 88 apolipoprotein C-I, isoform CRA_a [Mus musculus]
GI:158517825 GenBank EDL23175.1 88 apolipoprotein C-I, isoform CRA_a [Mus musculus]
GI:158517825 RefSeq XP_003752261.1 88 PREDICTED: apolipoprotein C-I [Rattus norvegicus]

Related Sequences to LMP000144 proteins

Reference Database Accession Length Protein Name
GI:158517825 EMBL CAA33536.1 88 apolipoprotein CI, preprotein [Rattus norvegicus]
GI:158517825 GenBank AAP97737.1 88 liver regeneration-related protein LRRG04 [Rattus norvegicus]
GI:158517825 RefSeq NP_036956.1 88 apolipoprotein C-I precursor [Rattus norvegicus]
GI:158517825 RefSeq NP_001103466.1 88 apolipoprotein C-I precursor [Rattus norvegicus]
GI:158517825 RefSeq XP_005370367.1 88 PREDICTED: apolipoprotein C-I [Microtus ochrogaster]
GI:158517825 SwissProt P19939.1 88 RecName: Full=Apolipoprotein C-I; Short=Apo-CIB; Short=ApoC-IB; AltName: Full=Apolipoprotein C1; AltName: Full=Liver regeneration-related protein LRRG04; Contains: RecName: Full=Truncated apolipoprotein C-I; Short=Apo-CIB'; Short=ApoC-IB'; Flags: Precursor [Rattus norvegicus]