Gene/Proteome Database (LMPD)
LMPD ID
LMP000160
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylcholine transfer protein
Gene Symbol
Synonyms
PC-TP; StarD2
Alternate Names
phosphatidylcholine transfer protein; START domain-containing protein 2; stAR-related lipid transfer protein 2
Chromosome
11
Map Location
11 C|11 54.7 cM
Proteins
phosphatidylcholine transfer protein | |
---|---|
Refseq ID | NP_032822 |
Protein GI | 117320552 |
UniProt ID | P53808 |
mRNA ID | NM_008796 |
Length | 214 |
RefSeq Status | VALIDATED |
MAGAACCFSDEQFREACAELQKPALTGADWQLLVEASGITIYRLLDQPSGLYEYKVFGVLEGCSPALLADVYMDLDYRKQWDQYVKELYEKESDEQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDGRKIYVVLAQSISAPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMVKACQNYHKKT |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylcholine transfer protein
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
GO:0031210 | ISS:UniProtKB | F | phosphatidylcholine binding |
GO:0008525 | ISS:UniProtKB | F | phosphatidylcholine transporter activity |
GO:0008203 | IMP:MGI | P | cholesterol metabolic process |
GO:0015914 | ISS:UniProtKB | P | phospholipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylcholine transfer protein
Protein Entry
PPCT_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule. |
Similarity | Contains 1 START domain. {ECO:0000255|PROSITE- ProRule:PRU00197}. |
Subcellular Location | Cytoplasm {ECO:0000269|PubMed:10500206}. |
Subunit | Interacts with ACOT13/THEM2. {ECO:0000269|PubMed:17704541}. |
Tissue Specificity | Abundant in liver of pups but levels in liver decrease 10-fold about 2 weeks after birth. In adult, highly expressed in epididymis, testis, kidney and bone-marrow derived mast cells. {ECO:0000269|PubMed:10500206}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000160 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
117320552 | RefSeq | NP_032822 | 214 | phosphatidylcholine transfer protein |
Identical Sequences to LMP000160 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:117320552 | GenBank | AAI40285.1 | 214 | Phosphatidylcholine transfer protein, partial [synthetic construct] |
GI:117320552 | GenBank | AAI56714.1 | 214 | Phosphatidylcholine transfer protein [synthetic construct] |
Related Sequences to LMP000160 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:117320552 | GenBank | AAF02537.1 | 214 | phosphatidylcholine transfer protein [Mus musculus] |
GI:117320552 | GenBank | EDL15879.1 | 214 | phosphatidylcholine transfer protein, isoform CRA_b [Mus musculus] |
GI:117320552 | RefSeq | NP_058921.1 | 214 | phosphatidylcholine transfer protein [Rattus norvegicus] |
GI:117320552 | RefSeq | XP_005350578.1 | 214 | PREDICTED: phosphatidylcholine transfer protein [Microtus ochrogaster] |
GI:117320552 | RefSeq | XP_006972080.1 | 214 | PREDICTED: phosphatidylcholine transfer protein [Peromyscus maniculatus bairdii] |
GI:117320552 | SwissProt | P53808.2 | 214 | RecName: Full=Phosphatidylcholine transfer protein; Short=PC-TP; AltName: Full=START domain-containing protein 2; Short=StARD2; AltName: Full=StAR-related lipid transfer protein 2 [Mus musculus] |