Gene/Proteome Database (LMPD)

LMPD ID
LMP000177
Gene ID
Species
Mus musculus (Mouse)
Gene Name
holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase)
Gene Symbol
Synonyms
410I21.SP6; D16Jhu34
Chromosome
16
Map Location
16 C4|16 55.12 cM

Proteins

biotin--protein ligase
Refseq ID NP_631884
Protein GI 20982837
UniProt ID Q3TZ03
mRNA ID NM_139145
Length 722
RefSeq Status PROVISIONAL
MEDRLQMDNGLIAQKIVSVHLKDPALKELGKASDKQVQGPPPGPEASPEAQPAQGVMEHAGQGDCKAAGEGPSPRRRGCAPESEPAADGDPGLSSPELCQLHLSICHECLELENSTIDSVRSASAENIPDLPCDHSGVEGAAGELCPERKGKRVNISGKAPNILLYVGSGSEEALGRLQQVRSVLTDCVDTDSYTLYHLLEDSALRDPWSDNCLLLVIASRDPIPKDIQHKFMAYLSQGGKVLGLSSPFTLGGFRVTRRDVLRNTVQNLVFSKADGTEVRLSVLSSGYVYEEGPSLGRLQGHLENEDKDKMIVHVPFGTLGGEAVLCQVHLELPPGASLVQTADDFNVLKSSNVRRHEVLKEILTALGLSCDAPQVPALTPLYLLLAAEETQDPFMQWLGRHTDPEGIIKSSKLSLQFVSSYTSEAEITPSSMPVVTDPEAFSSEHFSLETYRQNLQTTRLGKVILFAEVTSTTMSLLDGLMFEMPQEMGLIAIAVRQTQGKGRGPNAWLSPVGCALSTLLVFIPLRSQLGQRIPFVQHLMSLAVVEAVRSIPGYEDINLRVKWPNDIYYSDLMKIGGVLVNSTLMGETFYILIGCGFNVTNSNPTICINDLIEEHNKQHGAGLKPLRADCLIARAVTVLEKLIDRFQDQGPDGVLPLYYKYWVHGGQQVRLGSTEGPQASIVGLDDSGFLQVHQEDGGVVTVHPDGNSFDMLRNLIVPKRQ

Gene Information

Entrez Gene ID
Gene Name
holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase)
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000785 IEA:Ensembl C chromatin
GO:0005829 IEA:Ensembl C cytosol
GO:0005739 IDA:MGI C mitochondrion
GO:0005652 IEA:Ensembl C nuclear lamina
GO:0016363 IEA:Ensembl C nuclear matrix
GO:0009374 IEA:Ensembl F biotin binding
GO:0004077 IEA:InterPro F biotin-[acetyl-CoA-carboxylase] ligase activity
GO:0004080 IEA:Ensembl F biotin-[propionyl-CoA-carboxylase (ATP-hydrolyzing)] ligase activity
GO:0008283 IEA:Ensembl P cell proliferation
GO:0071110 IEA:Ensembl P histone biotinylation
GO:0070781 IEA:Ensembl P response to biotin

Domain Information

InterPro Annotations

Accession Description
IPR003142 Biotin protein ligase, C-terminal
IPR004408 Biotin--acetyl-CoA-carboxylase ligase
IPR004143 Biotin/lipoate A/B protein ligase

UniProt Annotations

Entry Information

Gene Name
holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase)
Protein Entry
BPL1_MOUSE
UniProt ID
Species
Mouse

Identical and Related Proteins

Unique RefSeq proteins for LMP000177 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20982837 RefSeq NP_631884 722 biotin--protein ligase

Identical Sequences to LMP000177 proteins

Reference Database Accession Length Protein Name
GI:20982837 DBBJ BAE34407.1 722 unnamed protein product [Mus musculus]
GI:20982837 GenBank AAH50090.1 722 Holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase) [Mus musculus]
GI:20982837 GenBank EDL03749.1 722 holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase), isoform CRA_a [Mus musculus]
GI:20982837 RefSeq XP_006522918.1 722 PREDICTED: biotin--protein ligase isoform X6 [Mus musculus]
GI:20982837 RefSeq XP_006522919.1 722 PREDICTED: biotin--protein ligase isoform X7 [Mus musculus]
GI:20982837 SwissProt Q920N2.1 722 RecName: Full=Biotin--protein ligase; AltName: Full=Biotin apo-protein ligase; Includes: RecName: Full=Biotin--[methylmalonyl-CoA-carboxytransferase] ligase; Includes: RecName: Full=Biotin--[propionyl-CoA-carboxylase [ATP-hydrolyzing]] ligase; AltName: Full=Holocarboxylase synthetase; Short=HCS; Includes: RecName: Full=Biotin--[methylcrotonoyl-CoA-carboxylase] ligase; Includes: RecName: Full=Biotin--[acetyl-CoA-carboxylase] ligase [Mus musculus]

Related Sequences to LMP000177 proteins

Reference Database Accession Length Protein Name
GI:20982837 GenBank EDL76724.1 870 similar to homolog of Human holocarboxylase synthetase gene HLCS (predicted) [Rattus norvegicus]
GI:20982837 RefSeq XP_006221149.1 870 PREDICTED: biotin--protein ligase isoform X3 [Rattus norvegicus]
GI:20982837 RefSeq XP_006522913.1 1011 PREDICTED: biotin--protein ligase isoform X1 [Mus musculus]
GI:20982837 RefSeq XP_006522914.1 881 PREDICTED: biotin--protein ligase isoform X2 [Mus musculus]
GI:20982837 RefSeq XP_006522915.1 836 PREDICTED: biotin--protein ligase isoform X3 [Mus musculus]
GI:20982837 RefSeq XP_008766833.1 870 PREDICTED: biotin--protein ligase isoform X3 [Rattus norvegicus]