Gene/Proteome Database (LMPD)
LMPD ID
LMP000180
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylinositol transfer protein, alpha
Gene Symbol
Synonyms
Pitpn; vb; vibrator
Alternate Names
phosphatidylinositol transfer protein alpha isoform; Pitp alpha; PI-TP-alpha; ptdInsTP alpha; ptdIns transfer protein alpha
Chromosome
11
Map Location
11 B5|11 45.92 cM
Proteins
phosphatidylinositol transfer protein alpha isoform | |
---|---|
Refseq ID | NP_032876 |
Protein GI | 6679337 |
UniProt ID | P53810 |
mRNA ID | NM_008850 |
Length | 271 |
RefSeq Status | PROVISIONAL |
MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol transfer protein, alpha
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | TAS:Reactome | C | cytosol |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016021 | ISS:MGI | C | integral component of membrane |
GO:0008289 | ISS:MGI | F | lipid binding |
GO:0005543 | ISO:MGI | F | phospholipid binding |
GO:0006810 | IEA:UniProtKB-KW | P | transport |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol transfer protein, alpha
Protein Entry
PIPNA_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Disease | Note=Defects in Pitpna are the cause of the vibrator phenotype which is characterized by early-onset progressive action tremor, degeneration of brain stem and spinal cord neurons, and juvenile death. The mutation is due to the insertion of an intracisternal A particle retrotransposon in intron 4 which results in a 5-fold reduction in protein levels. {ECO:0000269|PubMed:9182797}. |
Function | Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes. |
Similarity | Belongs to the PtdIns transfer protein family. PI transfer class I subfamily. {ECO:0000305}. |
Subcellular Location | Cytoplasm. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000180 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6679337 | RefSeq | NP_032876 | 271 | phosphatidylinositol transfer protein alpha isoform |
Identical Sequences to LMP000180 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6679337 | DBBJ | BAE32103.1 | 271 | unnamed protein product [Mus musculus] |
GI:6679337 | DBBJ | BAE25972.1 | 271 | unnamed protein product [Mus musculus] |
GI:6679337 | DBBJ | BAE30448.1 | 271 | unnamed protein product [Mus musculus] |
GI:6679337 | DBBJ | BAE40147.1 | 271 | unnamed protein product [Mus musculus] |
GI:6679337 | DBBJ | BAE30939.1 | 271 | unnamed protein product [Mus musculus] |
GI:6679337 | GenBank | ABK42306.1 | 271 | PI-TP alpha [synthetic construct] |
Related Sequences to LMP000180 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6679337 | DBBJ | BAE40562.1 | 347 | unnamed protein product, partial [Mus musculus] |
GI:6679337 | DBBJ | BAE38321.1 | 347 | unnamed protein product, partial [Mus musculus] |
GI:6679337 | GenBank | AAA41984.1 | 271 | phosphatidylinositol transfer protein [Rattus norvegicus] |
GI:6679337 | GenBank | AAH70945.1 | 271 | Phosphatidylinositol transfer protein, alpha [Rattus norvegicus] |
GI:6679337 | RefSeq | NP_058927.1 | 271 | phosphatidylinositol transfer protein alpha isoform [Rattus norvegicus] |
GI:6679337 | SwissProt | P16446.2 | 271 | RecName: Full=Phosphatidylinositol transfer protein alpha isoform; Short=PI-TP-alpha; Short=PtdIns transfer protein alpha; Short=PtdInsTP alpha [Rattus norvegicus] |