Gene/Proteome Database (LMPD)

LMPD ID
LMP000180
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylinositol transfer protein, alpha
Gene Symbol
Synonyms
Pitpn; vb; vibrator
Alternate Names
phosphatidylinositol transfer protein alpha isoform; Pitp alpha; PI-TP-alpha; ptdInsTP alpha; ptdIns transfer protein alpha
Chromosome
11
Map Location
11 B5|11 45.92 cM

Proteins

phosphatidylinositol transfer protein alpha isoform
Refseq ID NP_032876
Protein GI 6679337
UniProt ID P53810
mRNA ID NM_008850
Length 271
RefSeq Status PROVISIONAL
MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSVKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD

Gene Information

Entrez Gene ID
Gene Name
phosphatidylinositol transfer protein, alpha
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:Reactome C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 ISS:MGI C integral component of membrane
GO:0008289 ISS:MGI F lipid binding
GO:0005543 ISO:MGI F phospholipid binding
GO:0006810 IEA:UniProtKB-KW P transport

REACTOME Pathway Links

REACTOME Pathway ID Description
5893043 Developmental Biology
5893637 Netrin-1 signaling
5893750 Role of second messengers in netrin-1 signaling

Domain Information

InterPro Annotations

Accession Description
IPR001666 Phosphatidylinositol transfer protein
IPR023393 START-like domain

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol transfer protein, alpha
Protein Entry
PIPNA_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Disease Note=Defects in Pitpna are the cause of the vibrator phenotype which is characterized by early-onset progressive action tremor, degeneration of brain stem and spinal cord neurons, and juvenile death. The mutation is due to the insertion of an intracisternal A particle retrotransposon in intron 4 which results in a 5-fold reduction in protein levels. {ECO:0000269|PubMed:9182797}.
Function Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes.
Similarity Belongs to the PtdIns transfer protein family. PI transfer class I subfamily. {ECO:0000305}.
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP000180 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6679337 RefSeq NP_032876 271 phosphatidylinositol transfer protein alpha isoform

Identical Sequences to LMP000180 proteins

Reference Database Accession Length Protein Name
GI:6679337 DBBJ BAE32103.1 271 unnamed protein product [Mus musculus]
GI:6679337 DBBJ BAE25972.1 271 unnamed protein product [Mus musculus]
GI:6679337 DBBJ BAE30448.1 271 unnamed protein product [Mus musculus]
GI:6679337 DBBJ BAE40147.1 271 unnamed protein product [Mus musculus]
GI:6679337 DBBJ BAE30939.1 271 unnamed protein product [Mus musculus]
GI:6679337 GenBank ABK42306.1 271 PI-TP alpha [synthetic construct]

Related Sequences to LMP000180 proteins

Reference Database Accession Length Protein Name
GI:6679337 DBBJ BAE40562.1 347 unnamed protein product, partial [Mus musculus]
GI:6679337 DBBJ BAE38321.1 347 unnamed protein product, partial [Mus musculus]
GI:6679337 GenBank AAA41984.1 271 phosphatidylinositol transfer protein [Rattus norvegicus]
GI:6679337 GenBank AAH70945.1 271 Phosphatidylinositol transfer protein, alpha [Rattus norvegicus]
GI:6679337 RefSeq NP_058927.1 271 phosphatidylinositol transfer protein alpha isoform [Rattus norvegicus]
GI:6679337 SwissProt P16446.2 271 RecName: Full=Phosphatidylinositol transfer protein alpha isoform; Short=PI-TP-alpha; Short=PtdIns transfer protein alpha; Short=PtdInsTP alpha [Rattus norvegicus]