Gene/Proteome Database (LMPD)
LMPD ID
LMP000219
Gene ID
Species
Mus musculus (Mouse)
Gene Name
retinoic acid receptor, gamma
Gene Symbol
Synonyms
Nr1b3; RAR-gamma; RARD; RARgamma2
Alternate Names
retinoic acid receptor gamma; RAR gamma 2; nuclear receptor subfamily 1 group B member 3
Chromosome
15
Map Location
15 E-F3|15 57.4 cM
Proteins
retinoic acid receptor gamma isoform 1 | |
---|---|
Refseq ID | NP_035374 |
Protein GI | 112181202 |
UniProt ID | P18911 |
mRNA ID | NM_011244 |
Length | 458 |
RefSeq Status | VALIDATED |
MATNKERLFAPGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSKPGPHPKASSEDEAPGGQGKRGQSPQPDQGP |
retinoic acid receptor gamma isoform 2 | |
---|---|
Refseq ID | NP_001036192 |
Protein GI | 112181196 |
UniProt ID | P18911 |
mRNA ID | NM_001042727 |
Length | 447 |
RefSeq Status | VALIDATED |
MYDCMESFVPGPRRLYGAAGPGAGLLRRATGSSCFAGLESFAWAQPASLQSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSKPGPHPKASSEDEAPGGQGKRGQSPQPDQGP |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005634 | IDA:MGI | C | nucleus |
GO:0005667 | IDA:BHF-UCL | C | transcription factor complex |
GO:0003677 | IC:BHF-UCL | F | DNA binding |
GO:0000977 | IDA:MGI | F | RNA polymerase II regulatory region sequence-specific DNA binding |
GO:0003708 | IEA:Ensembl | F | retinoic acid receptor activity |
GO:0046965 | IMP:BHF-UCL | F | retinoid X receptor binding |
GO:0003700 | IDA:BHF-UCL | F | sequence-specific DNA binding transcription factor activity |
GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0070384 | IMP:MGI | P | Harderian gland development |
GO:0009952 | IMP:MGI | P | anterior/posterior pattern specification |
GO:0060348 | IMP:UniProtKB | P | bone development |
GO:0060349 | IMP:MGI | P | bone morphogenesis |
GO:0043010 | IGI:MGI | P | camera-type eye development |
GO:0071300 | IDA:MGI | P | cellular response to retinoic acid |
GO:0002063 | IMP:UniProtKB | P | chondrocyte development |
GO:0031076 | IGI:MGI | P | embryonic camera-type eye development |
GO:0048048 | IGI:MGI | P | embryonic eye morphogenesis |
GO:0035116 | IGI:MGI | P | embryonic hindlimb morphogenesis |
GO:0060429 | IMP:MGI | P | epithelium development |
GO:0060324 | IGI:MGI | P | face development |
GO:0048732 | IMP:MGI | P | gland development |
GO:0002068 | IGI:MGI | P | glandular epithelial cell development |
GO:0003430 | IMP:UniProtKB | P | growth plate cartilage chondrocyte growth |
GO:0003417 | IGI:MGI | P | growth plate cartilage development |
GO:0060173 | IMP:UniProtKB | P | limb development |
GO:0035264 | IGI:MGI | P | multicellular organism growth |
GO:0043066 | IGI:MGI | P | negative regulation of apoptotic process |
GO:0061037 | IMP:MGI | P | negative regulation of cartilage development |
GO:0045596 | IMP:MGI | P | negative regulation of cell differentiation |
GO:0008285 | IGI:MGI | P | negative regulation of cell proliferation |
GO:0032331 | IMP:MGI | P | negative regulation of chondrocyte differentiation |
GO:0000122 | IDA:MGI | P | negative regulation of transcription from RNA polymerase II promoter |
GO:0001843 | IGI:MGI | P | neural tube closure |
GO:0043065 | IGI:MGI | P | positive regulation of apoptotic process |
GO:0008284 | IGI:MGI | P | positive regulation of cell proliferation |
GO:0010628 | IDA:MGI | P | positive regulation of gene expression |
GO:0043068 | IGI:MGI | P | positive regulation of programmed cell death |
GO:0045944 | IC:BHF-UCL | P | positive regulation of transcription from RNA polymerase II promoter |
GO:0060740 | IMP:MGI | P | prostate gland epithelium morphogenesis |
GO:0010468 | IGI:MGI | P | regulation of gene expression |
GO:0031641 | IEA:Ensembl | P | regulation of myelination |
GO:0048608 | IMP:MGI | P | reproductive structure development |
GO:0060041 | IGI:MGI | P | retina development in camera-type eye |
GO:0003406 | IGI:MGI | P | retinal pigment epithelium development |
GO:0048384 | IMP:MGI | P | retinoic acid receptor signaling pathway |
GO:0060534 | IMP:MGI | P | trachea cartilage development |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5893658 | Nuclear Receptor transcription pathway |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=A; IsoId=P18911-1; Sequence=Displayed; Name=2; Synonyms=B; IsoId=P18911-2, P20787-1; Sequence=VSP_031082; Name=3; IsoId=P18911-3; Sequence=VSP_031081; |
Developmental Stage | In E9.5-E12.5 embryos, expression throughout limb bud mesenchyme. This expression overlaps with that of CYP26B1. Also strongly expressed in the caudal and craniofacial regions. {ECO:0000269|PubMed:20043900}. |
Disruption Phenotype | Rarg and Rarb double null mice exhibit growth retardation 3 weeks after birth. Defects are found in the growth plates with deficiency in cartilage. Growth retardation was noticable in limb sketal elements such as femurs. Early lethality and male sterility due to squamous metaplasia of the seminal vesicles and prostate are also observed. Isoform 2 mutants appear normal. The Rarg and Cyp26b1 double null mutation is able to partially rescue limb skeletal morphology without restoring normal expression of proximo-distal patterning genes. {ECO:0000269|PubMed:19389355, ECO:0000269|PubMed:20043900, ECO:0000269|PubMed:8388780}. |
Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. |
Function | Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, acts mainly as an activator of gene expression due to weak binding to corepressors (By similarity). Required for limb bud development. In concert with RARA or RARB, required for skeletal growth, matrix homeostasis and growth plate function. {ECO:0000250, ECO:0000269|PubMed:19389355, ECO:0000269|PubMed:8388780}. |
Similarity | Belongs to the nuclear hormone receptor family. NR1 subfamily. {ECO:0000305}. |
Similarity | Contains 1 nuclear receptor DNA-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00407}. |
Subcellular Location | Nucleus {ECO:0000255|PROSITE- ProRule:PRU00407, ECO:0000269|PubMed:15327771}. |
Subunit | Homodimer (By similarity). Heterodimer with a RXR molecule (By similarity). Binds DNA preferentially as a RAR/RXR heterodimer (By similarity). Forms a complex with PUS1 and the SRA1 RNA in the nucleus. {ECO:0000250, ECO:0000269|PubMed:15327771}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000219 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
112181202 | RefSeq | NP_035374 | 458 | retinoic acid receptor gamma isoform 1 |
112181196 | RefSeq | NP_001036192 | 447 | retinoic acid receptor gamma isoform 2 |
Identical Sequences to LMP000219 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:112181202 | EMBL | CAA33845.1 | 458 | Retinoic acid receptor gamma [Mus musculus] |
GI:112181202 | GenBank | AAH12923.1 | 458 | Retinoic acid receptor, gamma [Mus musculus] |
GI:112181202 | GenBank | EDL03996.1 | 458 | retinoic acid receptor, gamma [Mus musculus] |
GI:112181202 | RefSeq | XP_006520712.1 | 458 | PREDICTED: retinoic acid receptor gamma isoform X1 [Mus musculus] |
GI:112181202 | RefSeq | XP_006520713.1 | 458 | PREDICTED: retinoic acid receptor gamma isoform X2 [Mus musculus] |
GI:112181202 | SwissProt | P18911.3 | 458 | RecName: Full=Retinoic acid receptor gamma; Short=RAR-gamma; AltName: Full=Nuclear receptor subfamily 1 group B member 3 [Mus musculus] |
Related Sequences to LMP000219 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:112181202 | DBBJ | BAE28323.1 | 458 | unnamed protein product [Mus musculus] |
GI:112181202 | GenBank | AAA40035.1 | 458 | retinoic acid receptor gamma [Mus musculus] |
GI:112181196 | GenBank | AAA40036.1 | 447 | retinoic acid receptor gamma [Mus musculus] |
GI:112181202 | GenBank | AAH13709.1 | 458 | Retinoic acid receptor, gamma [Mus musculus] |
GI:112181202 | GenBank | EDL86852.1 | 458 | rCG50849 [Rattus norvegicus] |
GI:112181196 | GenBank | ERE83635.1 | 447 | retinoic acid receptor gamma isoform 2 [Cricetulus griseus] |
GI:112181202 | PRF | - | 458 | retinoic acid receptor gamma [Mus musculus] |
GI:112181196 | RefSeq | XP_003507258.1 | 485 | PREDICTED: retinoic acid receptor gamma isoform X1 [Cricetulus griseus] |
GI:112181196 | RefSeq | XP_007614454.1 | 447 | PREDICTED: retinoic acid receptor gamma isoform X4 [Cricetulus griseus] |
GI:112181196 | RefSeq | XP_007614455.1 | 447 | PREDICTED: retinoic acid receptor gamma isoform X5 [Cricetulus griseus] |
GI:112181196 | RefSeq | XP_008764006.1 | 471 | PREDICTED: retinoic acid receptor gamma isoform X2 [Rattus norvegicus] |
GI:112181202 | RefSeq | XP_008764007.1 | 458 | PREDICTED: retinoic acid receptor gamma isoform X1 [Rattus norvegicus] |