Gene/Proteome Database (LMPD)
LMPD ID
LMP000221
Gene ID
Species
Homo sapiens (Human)
Gene Name
annexin A11
Gene Symbol
Synonyms
ANX11; CAP50
Alternate Names
annexin A11; CAP-50; annexin XI; annexin-11; 56 kDa autoantigen; autoantigen, 56-kD; calcyclin-associated annexin 50
Chromosome
10
Map Location
10q23
Summary
This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain the calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, May 2013]
Orthologs
Proteins
| annexin A11 isoform 1 | |
|---|---|
| Refseq ID | NP_665875 |
| Protein GI | 22165431 |
| UniProt ID | P50995 |
| mRNA ID | NM_145868 |
| Length | 505 |
| RefSeq Status | REVIEWED |
| MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND | |
| annexin A11 isoform 1 | |
|---|---|
| Refseq ID | NP_001265337 |
| Protein GI | 508772597 |
| UniProt ID | P50995 |
| mRNA ID | NM_001278408 |
| Length | 505 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:22165431 (mRNA isoform) | |
| annexin A11 isoform 1 | |
|---|---|
| Refseq ID | NP_001148 |
| Protein GI | 4557317 |
| UniProt ID | P50995 |
| mRNA ID | NM_001157 |
| Length | 505 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:22165431 (mRNA isoform) | |
| annexin A11 isoform 1 | |
|---|---|
| Refseq ID | NP_001265336 |
| Protein GI | 508772595 |
| UniProt ID | P50995 |
| mRNA ID | NM_001278407 |
| Length | 505 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:22165431 (mRNA isoform) | |
| annexin A11 isoform 1 | |
|---|---|
| Refseq ID | NP_665876 |
| Protein GI | 22165433 |
| UniProt ID | P50995 |
| mRNA ID | NM_145869 |
| Length | 505 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:22165431 (mRNA isoform) | |
| annexin A11 isoform 2 | |
|---|---|
| Refseq ID | NP_001265338 |
| Protein GI | 508772599 |
| UniProt ID | P50995 |
| mRNA ID | NM_001278409 |
| Length | 472 |
| RefSeq Status | REVIEWED |
| MPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0042582 | IDA:UniProtKB | C | azurophil granule |
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0030496 | IDA:UniProtKB | C | midbody |
| GO:0005635 | IDA:UniProtKB | C | nuclear envelope |
| GO:0005654 | IDA:UniProtKB | C | nucleoplasm |
| GO:0005634 | IDA:HPA | C | nucleus |
| GO:0045335 | IDA:UniProtKB | C | phagocytic vesicle |
| GO:0042581 | IDA:UniProtKB | C | specific granule |
| GO:0005819 | IDA:UniProtKB | C | spindle |
| GO:0023026 | IDA:UniProt | F | MHC class II protein complex binding |
| GO:0044548 | IPI:UniProtKB | F | S100 protein binding |
| GO:0005509 | IEA:Ensembl | F | calcium ion binding |
| GO:0005544 | IEA:UniProtKB-KW | F | calcium-dependent phospholipid binding |
| GO:0048306 | IPI:UniProtKB | F | calcium-dependent protein binding |
| GO:0008429 | IEA:Ensembl | F | phosphatidylethanolamine binding |
| GO:0044822 | IDA:UniProtKB | F | poly(A) RNA binding |
| GO:0007109 | IMP:UniProtKB | P | cytokinesis, completion of separation |
| GO:0006909 | IEP:UniProtKB | P | phagocytosis |
| GO:0051592 | IDA:UniProtKB | P | response to calcium ion |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P50995-1; Sequence=Displayed; Name=2; IsoId=P50995-2; Sequence=VSP_054553; Note=No experimental confirmation available.; |
| Domain | A pair of annexin repeats may form one binding site for calcium and phospholipid. |
| Function | Binds specifically to calcyclin in a calcium-dependent manner (By similarity). Required for midbody formation and completion of the terminal phase of cytokinesis. {ECO |
| Similarity | Belongs to the annexin family. |
| Similarity | Contains 4 annexin repeats. |
| Subcellular Location | Cytoplasm. Melanosome. Nucleus envelope. Nucleus, nucleoplasm. Cytoplasm, cytoskeleton, spindle. Note=Found throughout the nucleoplasm at interphase and during mitosis concentrates around the mitotic apparatus (By similarity). Elevation of intracellular calcium causes relocalization from the nucleoplasm to the nuclear envelope, with little effect on the cytoplasmic pool. Localization to the nuclear envelope is cell- cycle dependent. |
| Subunit | Interacts with S100A6 (By similarity). Interacts with PDCD6 in a calcium-dependent manner. Interacts with KIF23 during cytokinesis. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP000221 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 22165431 | RefSeq | NP_665875 | 505 | annexin A11 isoform 1 |
| 508772599 | RefSeq | NP_001265338 | 472 | annexin A11 isoform 2 |
Identical Sequences to LMP000221 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:508772599 | DBBJ | BAG62659.1 | 472 | unnamed protein product [Homo sapiens] |
| GI:22165431 | GenBank | JAA21950.1 | 505 | annexin A11 [Pan troglodytes] |
| GI:22165431 | GenBank | AFX11683.1 | 505 | Sequence 15 from patent US 8293522 |
| GI:22165431 | GenBank | AIC48270.1 | 505 | ANXA11, partial [synthetic construct] |
| GI:22165431 | RefSeq | NP_001265336.1 | 505 | annexin A11 isoform 1 [Homo sapiens] |
| GI:22165431 | RefSeq | NP_001265337.1 | 505 | annexin A11 isoform 1 [Homo sapiens] |
| GI:22165431 | RefSeq | XP_009457060.1 | 505 | PREDICTED: annexin A11 [Pan troglodytes] |
Related Sequences to LMP000221 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22165431 | GenBank | AAX41290.1 | 505 | annexin A11 [synthetic construct] |
| GI:22165431 | GenBank | ACM82123.1 | 557 | Sequence 7621 from patent US 6812339 |
| GI:508772599 | GenBank | ADA20858.1 | 505 | Sequence 2682 from patent US 7608413 |
| GI:508772599 | GenBank | ADA20859.1 | 505 | Sequence 2683 from patent US 7608413 |
| GI:508772599 | GenBank | ADA20860.1 | 505 | Sequence 2684 from patent US 7608413 |
| GI:508772599 | GenBank | ADA20861.1 | 505 | Sequence 2685 from patent US 7608413 |
| GI:508772599 | GenBank | ADA20862.1 | 505 | Sequence 2686 from patent US 7608413 |
| GI:508772599 | GenBank | ADA20863.1 | 505 | Sequence 2687 from patent US 7608413 |
| GI:22165431 | GenBank | ADT50377.1 | 1075 | Sequence 2394 from patent US 7842467 |
| GI:22165431 | GenBank | ADT50378.1 | 837 | Sequence 2395 from patent US 7842467 |
| GI:22165431 | GenBank | ADT50379.1 | 853 | Sequence 2396 from patent US 7842467 |
| GI:22165431 | GenBank | ADT50384.1 | 1049 | Sequence 2401 from patent US 7842467 |