Gene/Proteome Database (LMPD)
LMPD ID
LMP000239
Gene ID
Species
Mus musculus (Mouse)
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Gene Symbol
Synonyms
AI195831; Nrbf1
Alternate Names
trans-2-enoyl-CoA reductase, mitochondrial; nuclear receptor binding factor 1
Chromosome
4
Map Location
4 D2.3|4
EC Number
1.3.1.38
Proteins
trans-2-enoyl-CoA reductase, mitochondrial precursor | |
---|---|
Refseq ID | NP_079573 |
Protein GI | 227116358 |
UniProt ID | Q9DCS3 |
mRNA ID | NM_025297 |
Length | 373 |
RefSeq Status | VALIDATED |
MLVSQRVTGARARAPQLAGLLEAWYRHGRTTSSYSALSEPSRVRALVYGNHGDPAKVVQLKNLELTAVEGSDVHVRMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQVIAVGSSVSALKPGDWVIPANAGLGTWRTEAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALRLKTINVVRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKTIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSLLIFKDLKLRGFWLSQWKKNHSPDEFKELILTLCNLIRQGRLTAPSCSEVPLQGYQQALEASMKPFVSSKQILTM | |
transit_peptide: 1..53 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q9DCS3.2) calculated_mol_wt: 5815 peptide sequence: MLVSQRVTGARARAPQLAGLLEAWYRHGRTTSSYSALSEPSRVRALVYGNHGD mat_peptide: 54..373 product: Trans-2-enoyl-CoA reductase, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9DCS3.2) calculated_mol_wt: 34546 peptide sequence: PAKVVQLKNLELTAVEGSDVHVRMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQVIAVGSSVSALKPGDWVIPANAGLGTWRTEAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALRLKTINVVRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKTIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSLLIFKDLKLRGFWLSQWKKNHSPDEFKELILTLCNLIRQGRLTAPSCSEVPLQGYQQALEASMKPFVSSKQILTM |
Gene Information
Entrez Gene ID
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | ISO:MGI | C | cytosol |
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0005634 | ISO:MGI | C | nucleus |
GO:0016922 | ISO:MGI | F | ligand-dependent nuclear receptor binding |
GO:0019166 | IEA:UniProtKB-EC | F | trans-2-enoyl-CoA reductase (NADPH) activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
mitochondrial trans-2-enoyl-CoA reductase
Protein Entry
MECR_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + NADP(+) = trans-2,3-dehydroacyl-CoA + NADPH. |
Function | Oxidoreductase with a preference for short and medium chain substrates, including trans-2-hexenoyl-CoA (C6), trans-2- decenoyl-CoA (C10), and trans-2-hexadecenoyl-CoA (C16). May play a role in mitochondrial fatty acid synthesis (By similarity). {ECO:0000250}. |
Similarity | Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. {ECO:0000305}. |
Subcellular Location | Mitochondrion {ECO:0000250}. |
Subunit | Homodimer. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000239 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
227116358 | RefSeq | NP_079573 | 373 | trans-2-enoyl-CoA reductase, mitochondrial precursor |
Identical Sequences to LMP000239 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:227116358 | GenBank | AAH03864.1 | 373 | Mitochondrial trans-2-enoyl-CoA reductase [Mus musculus] |
GI:227116358 | GenBank | EDL30126.1 | 373 | mitochondrial trans-2-enoyl-CoA reductase [Mus musculus] |
GI:227116358 | SwissProt | Q9DCS3.2 | 373 | RecName: Full=Trans-2-enoyl-CoA reductase, mitochondrial; Flags: Precursor [Mus musculus] |
Related Sequences to LMP000239 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:227116358 | DBBJ | BAA34804.1 | 373 | nuclear receptor binding factor-1 [Rattus norvegicus] |
GI:227116358 | DBBJ | BAB22169.1 | 373 | unnamed protein product [Mus musculus] |
GI:227116358 | GenBank | EDL80610.1 | 373 | mitochondrial trans-2-enoyl-CoA reductase, isoform CRA_b [Rattus norvegicus] |
GI:227116358 | RefSeq | NP_058905.1 | 373 | trans-2-enoyl-CoA reductase, mitochondrial precursor [Rattus norvegicus] |
GI:227116358 | RefSeq | XP_006538948.1 | 407 | PREDICTED: trans-2-enoyl-CoA reductase, mitochondrial isoform X1 [Mus musculus] |
GI:227116358 | SwissProt | Q9Z311.1 | 373 | RecName: Full=Trans-2-enoyl-CoA reductase, mitochondrial; AltName: Full=Nuclear receptor-binding factor 1; Short=NRBF-1; Flags: Precursor [Rattus norvegicus] |