Gene/Proteome Database (LMPD)

LMPD ID
LMP000246
Gene ID
Species
Homo sapiens (Human)
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
Gene Symbol
Synonyms
IV; SIAT3-C; SIAT3C; SIAT7-D; SIAT7D; ST6GALNACIV; ST6GalNAc
Chromosome
9
Map Location
9q34
EC Number
2.4.99.7
Summary
The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase isoform a
Refseq ID NP_778204
Protein GI 28373092
UniProt ID Q9H4F1
mRNA ID NM_175039
Length 302
RefSeq Status REVIEWED
MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYSSVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRTE
alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase isoform b
Refseq ID NP_778205
Protein GI 28373094
UniProt ID Q9H4F1
mRNA ID NM_175040
Length 218
RefSeq Status REVIEWED
MLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRTE

Gene Information

Entrez Gene ID
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 TAS:Reactome C Golgi membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0047290 IEA:UniProtKB-EC F (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl-galactosaminide 6-alpha-sialyltransferase activity
GO:0008373 TAS:ProtInc F sialyltransferase activity
GO:0016266 TAS:Reactome P O-glycan processing
GO:0044267 TAS:Reactome P cellular protein metabolic process
GO:0006664 TAS:ProtInc P glycolipid metabolic process
GO:0043687 TAS:Reactome P post-translational protein modification
GO:0097503 TAS:GOC P sialylation

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_200727 O-linked glycosylation
REACT_115606 O-linked glycosylation of mucins
REACT_200874 Sialic acid metabolism
REACT_115835 Termination of O-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29

UniProt Annotations

Entry Information

Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
Protein Entry
SIA7D_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Catalytic Activity CMP-N-acetylneuraminate + N-acetyl-alpha- neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-D- galactosaminyl-R = CMP + N-acetyl-alpha-neuraminyl-(2->3)-beta-D- galactosyl-(1->3)-(N-acetyl-alpha-neuraminyl-(2->6))-N-acetyl-D- galactosaminyl-R.
Function Involved in the biosynthesis of ganglioside GD1A from GM1B. Transfers CMP-NeuAc with an alpha-2,6-linkage to GalNAc residue on NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc of glycoproteins and glycolipids. Prefers glycoproteins to glycolipids (By similarity).
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 29 family.
Subcellular Location Golgi apparatus membrane ; Single-pass type II membrane protein .
Tissue Specificity Ubiquitous.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=ST6GalNAc IV; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_633";
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST6GALNAC4";

Identical and Related Proteins

Unique RefSeq proteins for LMP000246 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
28373092 RefSeq NP_778204 302 alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase isoform a
28373094 RefSeq NP_778205 218 alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase isoform b

Identical Sequences to LMP000246 proteins

Reference Database Accession Length Protein Name
GI:28373094 DBBJ BAF84738.1 218 unnamed protein product [Homo sapiens]
GI:28373092 EMBL CAS91685.1 302 unnamed protein product [Homo sapiens]
GI:28373092 GenBank EAW87717.1 302 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, isoform CRA_a [Homo sapiens]
GI:28373092 GenBank EAW87718.1 302 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, isoform CRA_a [Homo sapiens]
GI:28373092 GenBank EAW87719.1 302 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, isoform CRA_a [Homo sapiens]
GI:28373094 GenBank EAW87720.1 218 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, isoform CRA_b [Homo sapiens]
GI:28373092 GenBank ACG89841.1 302 Sequence 75 from patent US 7385034
GI:28373092 GenBank AIC51184.1 302 ST6GALNAC4, partial [synthetic construct]

Related Sequences to LMP000246 proteins

Reference Database Accession Length Protein Name
GI:28373092 DBBJ BAA91281.1 302 unnamed protein product [Homo sapiens]
GI:28373092 EMBL CAC07404.1 302 alpha2,6-sialyltransferase [Homo sapiens]
GI:28373094 EMBL CAC24981.1 302 unnamed protein product [Homo sapiens]
GI:28373094 EMBL CAC27250.1 302 unnamed protein product [Homo sapiens]
GI:28373094 EMBL CAS91685.1 302 unnamed protein product [Homo sapiens]
GI:28373092 GenBank AAF00102.1 302 NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase alpha2,6-sialyltransferase [Homo sapiens]
GI:28373094 GenBank AAP63349.1 302 Sequence 75 from patent US 6548633
GI:28373092 GenBank ACE22601.1 302 Sequence 7833 from patent US 7368531
GI:28373094 GenBank ACG89841.1 302 Sequence 75 from patent US 7385034
GI:28373092 GenBank ACH33352.1 302 Sequence 7833 from patent US 7411051
GI:28373094 GenBank AIC51184.1 302 ST6GALNAC4, partial [synthetic construct]
GI:28373092 RefSeq XP_002820286.1 302 PREDICTED: alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase [Pongo abelii]