Gene/Proteome Database (LMPD)
LMPD ID
LMP000246
Gene ID
Species
Homo sapiens (Human)
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
Gene Symbol
Synonyms
IV; SIAT3-C; SIAT3C; SIAT7-D; SIAT7D; ST6GALNACIV; ST6GalNAc
Chromosome
9
Map Location
9q34
EC Number
2.4.99.7
Summary
The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase isoform a | |
---|---|
Refseq ID | NP_778204 |
Protein GI | 28373092 |
UniProt ID | Q9H4F1 |
mRNA ID | NM_175039 |
Length | 302 |
RefSeq Status | REVIEWED |
MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYSSVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRTE |
alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase isoform b | |
---|---|
Refseq ID | NP_778205 |
Protein GI | 28373094 |
UniProt ID | Q9H4F1 |
mRNA ID | NM_175040 |
Length | 218 |
RefSeq Status | REVIEWED |
MLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRTE |
Gene Information
Entrez Gene ID
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0000139 | TAS:Reactome | C | Golgi membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0047290 | IEA:UniProtKB-EC | F | (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl-galactosaminide 6-alpha-sialyltransferase activity |
GO:0008373 | TAS:ProtInc | F | sialyltransferase activity |
GO:0044267 | TAS:Reactome | P | cellular protein metabolic process |
GO:0006664 | TAS:ProtInc | P | glycolipid metabolic process |
GO:0016266 | TAS:Reactome | P | O-glycan processing |
GO:0043687 | TAS:Reactome | P | post-translational protein modification |
GO:0097503 | TAS:GOC | P | sialylation |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_200727 | O-linked glycosylation |
REACT_115606 | O-linked glycosylation of mucins |
REACT_200874 | Sialic acid metabolism |
REACT_115835 | Termination of O-glycan biosynthesis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001675 | Glycosyl transferase, family 29 |
UniProt Annotations
Entry Information
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
Protein Entry
SIA7D_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Catalytic Activity | CMP-N-acetylneuraminate + N-acetyl-alpha- neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-D- galactosaminyl-R = CMP + N-acetyl-alpha-neuraminyl-(2->3)-beta-D- galactosyl-(1->3)-(N-acetyl-alpha-neuraminyl-(2->6))-N-acetyl-D- galactosaminyl-R. |
Function | Involved in the biosynthesis of ganglioside GD1A from GM1B. Transfers CMP-NeuAc with an alpha-2,6-linkage to GalNAc residue on NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc of glycoproteins and glycolipids. Prefers glycoproteins to glycolipids (By similarity). |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 29 family. |
Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
Tissue Specificity | Ubiquitous. |
Web Resource | Name=Functional Glycomics Gateway - GTase; Note=ST6GalNAc IV; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_633"; |
Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST6GALNAC4"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000246 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
28373092 | RefSeq | NP_778204 | 302 | alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase isoform a |
28373094 | RefSeq | NP_778205 | 218 | alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase isoform b |
Identical Sequences to LMP000246 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:28373094 | DBBJ | BAF84738.1 | 218 | unnamed protein product [Homo sapiens] |
GI:28373092 | EMBL | CAS91685.1 | 302 | unnamed protein product [Homo sapiens] |
GI:28373092 | GenBank | EAW87717.1 | 302 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, isoform CRA_a [Homo sapiens] |
GI:28373092 | GenBank | EAW87718.1 | 302 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, isoform CRA_a [Homo sapiens] |
GI:28373092 | GenBank | EAW87719.1 | 302 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, isoform CRA_a [Homo sapiens] |
GI:28373094 | GenBank | EAW87720.1 | 218 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4, isoform CRA_b [Homo sapiens] |
GI:28373092 | GenBank | ACG89841.1 | 302 | Sequence 75 from patent US 7385034 |
GI:28373092 | GenBank | AIC51184.1 | 302 | ST6GALNAC4, partial [synthetic construct] |
Related Sequences to LMP000246 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:28373092 | DBBJ | BAA91281.1 | 302 | unnamed protein product [Homo sapiens] |
GI:28373092 | EMBL | CAC07404.1 | 302 | alpha2,6-sialyltransferase [Homo sapiens] |
GI:28373094 | EMBL | CAC24981.1 | 302 | unnamed protein product [Homo sapiens] |
GI:28373094 | EMBL | CAC27250.1 | 302 | unnamed protein product [Homo sapiens] |
GI:28373094 | EMBL | CAS91685.1 | 302 | unnamed protein product [Homo sapiens] |
GI:28373092 | GenBank | AAF00102.1 | 302 | NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase alpha2,6-sialyltransferase [Homo sapiens] |
GI:28373094 | GenBank | AAP63349.1 | 302 | Sequence 75 from patent US 6548633 |
GI:28373092 | GenBank | ACE22601.1 | 302 | Sequence 7833 from patent US 7368531 |
GI:28373094 | GenBank | ACG89841.1 | 302 | Sequence 75 from patent US 7385034 |
GI:28373092 | GenBank | ACH33352.1 | 302 | Sequence 7833 from patent US 7411051 |
GI:28373094 | GenBank | AIC51184.1 | 302 | ST6GALNAC4, partial [synthetic construct] |
GI:28373092 | RefSeq | XP_002820286.1 | 302 | PREDICTED: alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase [Pongo abelii] |