Gene/Proteome Database (LMPD)

LMPD ID
LMP000253
Gene ID
Species
Mus musculus (Mouse)
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
Synonyms
1190002B21Rik; AU045265; b3Galt-V
Alternate Names
beta-1,3-galactosyltransferase 5; b3Gal-T5; beta3GalT5; beta3Gal-T5; beta-3-Gx-T5; SSEA-3 synthase; beta-1,3-GalTase 5; stage-specific embryonic antigen 3 synthase; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5
Chromosome
16
Map Location
16 C4|16
EC Number
2.4.1.-

Proteins

beta-1,3-galactosyltransferase 5
Refseq ID NP_149161
Protein GI 15011870
UniProt ID Q9JI67
mRNA ID NM_033149
Length 308
RefSeq Status VALIDATED
MAHMKTRLVYASILMMGALCLYFSMDSFRELPFVFKKSHGKFLQIPDIDCKQKPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVACHFMKPQDLLTYWQALENSKEQDCPAV
beta-1,3-galactosyltransferase 5
Refseq ID NP_001116465
Protein GI 172073167
UniProt ID Q9JI67
mRNA ID NM_001122993
Length 308
RefSeq Status VALIDATED
Protein sequence is identical to GI:15011870 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008378 IEA:InterPro F galactosyltransferase activity
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
mmu00603 Glycosphingolipid biosynthesis - globo series
mmu00601 Glycosphingolipid biosynthesis - lacto and neolacto series
mmu01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002659 Glycosyl transferase, family 31
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Protein Entry
B3GT5_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Function Catalyzes the transfer of Gal to GlcNAc-based acceptors with a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Can use glycolipid LC3Cer as an efficient acceptor. Also catalyzes the transfer of Gal to the terminal GalNAc unit of the globoside GB4, thereby synthesizing the glycolipid GB5, also known as the stage-specific embryonic antigen-3 (SSEA-3).
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 31 family. {ECO:0000305}.
Subcellular Location Golgi apparatus membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}.
Tissue Specificity Expressed in brain and kidney.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=b3GalT5; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_458";

Identical and Related Proteins

Unique RefSeq proteins for LMP000253 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15011870 RefSeq NP_149161 308 beta-1,3-galactosyltransferase 5

Identical Sequences to LMP000253 proteins

Reference Database Accession Length Protein Name
GI:15011870 GenBank EDL03681.1 308 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5, isoform CRA_a [Mus musculus]
GI:15011870 GenBank EDL03682.1 308 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5, isoform CRA_a [Mus musculus]
GI:15011870 GenBank EDL03683.1 308 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5, isoform CRA_a [Mus musculus]
GI:15011870 RefSeq NP_001116465.1 308 beta-1,3-galactosyltransferase 5 [Mus musculus]
GI:15011870 RefSeq XP_006523179.1 308 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Mus musculus]
GI:15011870 RefSeq XP_006523180.1 308 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X2 [Mus musculus]

Related Sequences to LMP000253 proteins

Reference Database Accession Length Protein Name
GI:15011870 GenBank EDL76658.1 308 rCG53114 [Rattus norvegicus]
GI:15011870 GenBank EGW12928.1 307 Beta-1,3-galactosyltransferase 5 [Cricetulus griseus]
GI:15011870 RefSeq NP_001099357.1 308 beta-1,3-galactosyltransferase 5 [Rattus norvegicus]
GI:15011870 RefSeq XP_006981448.1 308 PREDICTED: beta-1,3-galactosyltransferase 5 [Peromyscus maniculatus bairdii]
GI:15011870 RefSeq XP_008766791.1 308 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Rattus norvegicus]
GI:15011870 RefSeq XP_008766792.1 308 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Rattus norvegicus]