Gene/Proteome Database (LMPD)
LMPD ID
LMP000253
Gene ID
Species
Mus musculus (Mouse)
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
Synonyms
1190002B21Rik; AU045265; b3Galt-V
Alternate Names
beta-1,3-galactosyltransferase 5; b3Gal-T5; beta3GalT5; beta3Gal-T5; beta-3-Gx-T5; SSEA-3 synthase; beta-1,3-GalTase 5; stage-specific embryonic antigen 3 synthase; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5
Chromosome
16
Map Location
16 C4|16
EC Number
2.4.1.-
Proteins
beta-1,3-galactosyltransferase 5 | |
---|---|
Refseq ID | NP_149161 |
Protein GI | 15011870 |
UniProt ID | Q9JI67 |
mRNA ID | NM_033149 |
Length | 308 |
RefSeq Status | VALIDATED |
MAHMKTRLVYASILMMGALCLYFSMDSFRELPFVFKKSHGKFLQIPDIDCKQKPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVACHFMKPQDLLTYWQALENSKEQDCPAV |
beta-1,3-galactosyltransferase 5 | |
---|---|
Refseq ID | NP_001116465 |
Protein GI | 172073167 |
UniProt ID | Q9JI67 |
mRNA ID | NM_001122993 |
Length | 308 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:15011870 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008378 | IEA:InterPro | F | galactosyltransferase activity |
GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Protein Entry
B3GT5_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Catalyzes the transfer of Gal to GlcNAc-based acceptors with a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Can use glycolipid LC3Cer as an efficient acceptor. Also catalyzes the transfer of Gal to the terminal GalNAc unit of the globoside GB4, thereby synthesizing the glycolipid GB5, also known as the stage-specific embryonic antigen-3 (SSEA-3). |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 31 family. {ECO:0000305}. |
Subcellular Location | Golgi apparatus membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}. |
Tissue Specificity | Expressed in brain and kidney. |
Web Resource | Name=Functional Glycomics Gateway - GTase; Note=b3GalT5; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_458"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000253 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15011870 | RefSeq | NP_149161 | 308 | beta-1,3-galactosyltransferase 5 |
Identical Sequences to LMP000253 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15011870 | GenBank | EDL03681.1 | 308 | UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5, isoform CRA_a [Mus musculus] |
GI:15011870 | GenBank | EDL03682.1 | 308 | UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5, isoform CRA_a [Mus musculus] |
GI:15011870 | GenBank | EDL03683.1 | 308 | UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5, isoform CRA_a [Mus musculus] |
GI:15011870 | RefSeq | NP_001116465.1 | 308 | beta-1,3-galactosyltransferase 5 [Mus musculus] |
GI:15011870 | RefSeq | XP_006523179.1 | 308 | PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Mus musculus] |
GI:15011870 | RefSeq | XP_006523180.1 | 308 | PREDICTED: beta-1,3-galactosyltransferase 5 isoform X2 [Mus musculus] |
Related Sequences to LMP000253 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15011870 | GenBank | EDL76658.1 | 308 | rCG53114 [Rattus norvegicus] |
GI:15011870 | GenBank | EGW12928.1 | 307 | Beta-1,3-galactosyltransferase 5 [Cricetulus griseus] |
GI:15011870 | RefSeq | NP_001099357.1 | 308 | beta-1,3-galactosyltransferase 5 [Rattus norvegicus] |
GI:15011870 | RefSeq | XP_006981448.1 | 308 | PREDICTED: beta-1,3-galactosyltransferase 5 [Peromyscus maniculatus bairdii] |
GI:15011870 | RefSeq | XP_008766791.1 | 308 | PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Rattus norvegicus] |
GI:15011870 | RefSeq | XP_008766792.1 | 308 | PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Rattus norvegicus] |