Gene/Proteome Database (LMPD)

LMPD ID
LMP000258
Gene ID
5319
Species
Homo sapiens (Human)
Gene Name
phospholipase A2, group IB (pancreas)
Gene Symbol
PLA2G1B
Synonyms
PLA2; PLA2A; PPLA2
Alternate Names
phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B
Chromosome
12
Map Location
12q24.31
EC Number
3.1.1.4
Summary
This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response. [provided by RefSeq, Aug 2013]
Orthologs
View orthologs and multiple alignments for PLA2G1B

Proteins

phospholipase A2 precursor
Refseq ID NP_000919
Protein GI 4505847
UniProt ID P04054
mRNA ID NM_000928
Length 148
RefSeq Status VALIDATED
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
sig_peptide: 1..15 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1526 peptide sequence: MKLLVLAVLLTVAAA mat_peptide: 23..148 product: Phospholipase A2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P04054.3) calculated_mol_wt: 14139 peptide sequence: AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS

Gene Information

Entrez Gene ID
5319
Gene Name
phospholipase A2, group IB (pancreas)
Gene Symbol
PLA2G1B
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009986 IDA:BHF-UCL C cell surface
GO:0005576 TAS:Reactome C extracellular region
GO:0005615 IDA:BHF-UCL C extracellular space
GO:0030141 IEA:Ensembl C secretory granule
GO:0032052 ISS:BHF-UCL F bile acid binding
GO:0047498 IDA:BHF-UCL F calcium-dependent phospholipase A2 activity
GO:0005509 IDA:BHF-UCL F calcium ion binding
GO:0004623 IDA:BHF-UCL F phospholipase A2 activity
GO:0005102 IPI:UniProtKB F receptor binding
GO:0007015 TAS:ProtInc P actin filament organization
GO:0000187 ISS:BHF-UCL P activation of MAPK activity
GO:0032431 TAS:BHF-UCL P activation of phospholipase A2 activity
GO:0019731 IDA:UniProt P antibacterial humoral response
GO:0050482 TAS:BHF-UCL P arachidonic acid secretion
GO:0032869 ISS:BHF-UCL P cellular response to insulin stimulus
GO:0050830 IDA:UniProt P defense response to Gram-positive bacterium
GO:0006633 IDA:BHF-UCL P fatty acid biosynthetic process
GO:0015758 ISS:BHF-UCL P glucose transport
GO:0046474 TAS:Reactome P glycerophospholipid biosynthetic process
GO:0002227 IDA:UniProt P innate immune response in mucosa
GO:0032637 ISS:BHF-UCL P interleukin-8 production
GO:0035556 ISS:BHF-UCL P intracellular signal transduction
GO:0019370 ISS:BHF-UCL P leukotriene biosynthetic process
GO:0044240 IDA:BHF-UCL P multicellular organismal lipid catabolic process
GO:0030593 ISS:BHF-UCL P neutrophil chemotaxis
GO:0002446 ISS:BHF-UCL P neutrophil mediated immunity
GO:0006654 TAS:Reactome P phosphatidic acid biosynthetic process
GO:0036151 TAS:Reactome P phosphatidylcholine acyl-chain remodeling
GO:0046470 IDA:BHF-UCL P phosphatidylcholine metabolic process
GO:0036152 TAS:Reactome P phosphatidylethanolamine acyl-chain remodeling
GO:0036148 TAS:Reactome P phosphatidylglycerol acyl-chain remodeling
GO:0036149 TAS:Reactome P phosphatidylinositol acyl-chain remodeling
GO:0036150 TAS:Reactome P phosphatidylserine acyl-chain remodeling
GO:0006644 TAS:Reactome P phospholipid metabolic process
GO:0010524 ISS:BHF-UCL P positive regulation of calcium ion transport into cytosol
GO:0045740 IDA:BHF-UCL P positive regulation of DNA replication
GO:0048146 IC:BHF-UCL P positive regulation of fibroblast proliferation
GO:0050778 ISS:BHF-UCL P positive regulation of immune response
GO:0051092 ISS:BHF-UCL P positive regulation of NF-kappaB transcription factor activity
GO:0050714 TAS:BHF-UCL P positive regulation of protein secretion
GO:0045944 ISS:BHF-UCL P positive regulation of transcription from RNA polymerase II promoter
GO:0007165 TAS:ProtInc P signal transduction
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04975 Fat digestion and absorption
hsa04972 Pancreatic secretion
hsa04014 Ras signaling pathway
hsa04270 Vascular smooth muscle contraction

Domain Information

InterPro Annotations

Accession Description
IPR001211 Phospholipase A2
IPR013090 Phospholipase A2, active site
IPR016090 Phospholipase A2 domain

UniProt Annotations

Entry Information

Gene Name
phospholipase A2, group IB (pancreas)
Protein Entry
PA21B_HUMAN
UniProt ID
P04054
Species
Human

Comments

Comment Type Description
Catalytic Activity Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO
Cofactor Name=Ca(2+); Xref=ChEBI
Function PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides, this releases glycerophospholipids and arachidonic acid that serve as the precursors of signal molecules.
Ptm Activated by trypsin cleavage in the duodenum. Can also be activated by thrombin or autocatalytically.
Similarity Belongs to the phospholipase A2 family.
Subcellular Location Secreted . Note=secreted from pancreatic acinar cells in its inactive form.
Subunit Monomer or homodimer (By similarity). The inactive pro- form is a homotrimer.
Web Resource Name=NIEHS SNPs; URL="http://egp.gs.washington.edu/data/pla2g1b/";

Identical and Related Proteins

Unique RefSeq proteins for LMP000258 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4505847 RefSeq NP_000919 148 phospholipase A2 precursor

Identical Sequences to LMP000258 proteins

Reference Database Accession Length Protein Name
GI:4505847 GenBank ACT64452.1 148 phospholipase A2, group IB (pancreas) protein, partial [synthetic construct]
GI:4505847 GenBank AEU43284.1 148 Sequence 33 from patent US 8052970
GI:4505847 GenBank AFL59126.1 148 Sequence 108 from patent US 8105826
GI:4505847 GenBank AGF22439.1 148 Sequence 5 from patent US 8372594
GI:4505847 GenBank AHD76067.1 148 Sequence 18891 from patent US 8586006
GI:4505847 GenBank AIC49406.1 148 PLA2G1B, partial [synthetic construct]

Related Sequences to LMP000258 proteins

Reference Database Accession Length Protein Name
GI:4505847 RefSeq XP_001088684.1 148 PREDICTED: phospholipase A2 isoform 2 [Macaca mulatta]
GI:4505847 RefSeq XP_001160305.1 148 PREDICTED: phospholipase A2 [Pan troglodytes]
GI:4505847 RefSeq XP_003907296.1 148 PREDICTED: phospholipase A2 [Papio anubis]
GI:4505847 RefSeq XP_005572452.1 148 PREDICTED: phospholipase A2 isoform X2 [Macaca fascicularis]
GI:4505847 RefSeq XP_008003124.1 148 PREDICTED: phospholipase A2 [Chlorocebus sabaeus]
GI:4505847 RefSeq XP_010366588.1 148 PREDICTED: phospholipase A2 [Rhinopithecus roxellana]