Gene/Proteome Database (LMPD)
LMPD ID
LMP000269
Gene ID
Species
Mus musculus (Mouse)
Gene Name
acyl-CoA thioesterase 8
Gene Symbol
Synonyms
PTE-2; Pte1
Alternate Names
acyl-coenzyme A thioesterase 8; PTE-1; choloyl-coenzyme A thioesterase; peroxisomal acyl-CoA thioesterase 1; peroxisomal acyl-CoA thioesterase 2; peroxisomal long-chain acyl-CoA thioesterase 1; peroxisomal acyl-coenzyme A thioester hydrolase 1
Chromosome
2
Map Location
2 H3|2
EC Number
3.1.2.27
Proteins
| acyl-coenzyme A thioesterase 8 | |
|---|---|
| Refseq ID | NP_573503 |
| Protein GI | 254587964 |
| UniProt ID | P58137 |
| mRNA ID | NM_133240 |
| Length | 320 |
| RefSeq Status | VALIDATED |
| MSAPEGLGDAHGDADRGDLSGDLRSVLVTSVLNLEPLDEDLYRGRHYWVPTSQRLFGGQIMGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKVPVLYHVERIRTGASFSVRAVKAVQHGKAIFICQASFQQMQPSPLQHQFSMPSVPPPEDLLDHEALIDQYLRDPNLHKKYRVGLNRVAAQEVPIEIKVVNPPTLTQLQALEPKQMFWVRARGYIGEGDIKMHCCVAAYISDYAFLGTALLPHQSKYKVNFMASLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRRDGVLAVTCAQEGVIRLKPQVSESKL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0005782 | IEA:Ensembl | C | peroxisomal matrix |
| GO:0005777 | IDA:HGNC | C | peroxisome |
| GO:0047617 | IDA:MGI | F | acyl-CoA hydrolase activity |
| GO:0052689 | IEA:UniProtKB-KW | F | carboxylic ester hydrolase activity |
| GO:0033882 | IEA:UniProtKB-EC | F | choloyl-CoA hydrolase activity |
| GO:0052815 | IEA:Ensembl | F | medium-chain acyl-CoA hydrolase activity |
| GO:0016290 | IEA:Ensembl | F | palmitoyl-CoA hydrolase activity |
| GO:0006637 | IDA:MGI | P | acyl-CoA metabolic process |
| GO:0043649 | IEA:Ensembl | P | dicarboxylic acid catabolic process |
| GO:0016559 | IEA:Ensembl | P | peroxisome fission |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=29.4 uM for acetyl-CoA; KM=8.0 uM for propionyl-CoA; KM=22.6 uM for butyryl-CoA; KM=23.4 uM for hexanoyl-CoA; KM=6.9 uM for octanoyl-CoA; KM=2.9 uM for decanoyl-CoA; KM=2.5 uM for myristoyl-CoA; KM=1.7 uM for palmitoyl-CoA; KM=1.4 uM for palmitoleoyl-CoA; KM=1.6 uM for oleoyl-CoA; KM=4.2 uM for arachidoyl-CoA; KM=6.7 uM for arachidonoyl-CoA; KM=6.3 uM for trihydroxycoprostanoyl-CoA; KM=14.6 uM for choloyl-CoA; KM=8.8 uM for chenodeoxycholoyl-CoA; Note=In summary, KM for medium- to long-chain acyl CoAs is in the order 1.4-6.7 uM, and with short-chain acyl CoAs range from 8 to 30 uM. KM for bile acid-CoA esters is in the range 6-15 uM.; |
| Catalytic Activity | Choloyl-CoA + H(2)O = cholate + CoA. |
| Enzyme Regulation | Inhibited by CoASH (IC(50)= 10-15uM). Also inhibited by cysteine-reactive agents. |
| Function | Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Major thioesterase in peroxisomes. Competes with BAAT (Bile acid CoA: amino acid N-acyltransferase) for bile acid-CoA substrate (such as chenodeoxycholoyl-CoA). Shows a preference for medium- length fatty acyl-CoAs. May be involved in the metabolic regulation of peroxisome proliferation. |
| Induction | Induced in the liver, by peroxisome proliferator or fasting via the peroxisome proliferator-activated receptors (PPARs). Diurnal regulation of its expression. |
| Miscellaneous | Constitutes about 1% of total peroxisomal protein. |
| Similarity | Belongs to the C/M/P thioester hydrolase family. {ECO:0000305}. |
| Subcellular Location | Peroxisome. |
| Tissue Specificity | Ubiquitous. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000269 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 254587964 | RefSeq | NP_573503 | 320 | acyl-coenzyme A thioesterase 8 |
Identical Sequences to LMP000269 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254587964 | DBBJ | BAE30802.1 | 320 | unnamed protein product [Mus musculus] |
| GI:254587964 | GenBank | AAH05792.1 | 320 | Acyl-CoA thioesterase 8 [Mus musculus] |
| GI:254587964 | GenBank | EDL06422.1 | 320 | acyl-CoA thioesterase 8, isoform CRA_c [Mus musculus] |
| GI:254587964 | GenBank | ACQ18674.1 | 320 | Sequence 588 from patent US 7510850 |
| GI:254587964 | SwissProt | P58137.1 | 320 | RecName: Full=Acyl-coenzyme A thioesterase 8; Short=Acyl-CoA thioesterase 8; AltName: Full=Choloyl-coenzyme A thioesterase; AltName: Full=Peroxisomal acyl-CoA thioesterase 2; Short=PTE-2; AltName: Full=Peroxisomal acyl-coenzyme A thioester hydrolase 1; Short=PTE-1; AltName: Full=Peroxisomal long-chain acyl-CoA thioesterase 1 [Mus musculus] |
Related Sequences to LMP000269 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254587964 | GenBank | AAL35333.1 | 320 | peroxisomal acyl-CoA thioesterase 2 [Mus musculus] |
| GI:254587964 | GenBank | AAL66289.1 | 320 | peroxisomal thioesterase 1 [Rattus norvegicus] |
| GI:254587964 | GenBank | AAH78751.1 | 320 | Acyl-CoA thioesterase 8 [Rattus norvegicus] |
| GI:254587964 | GenBank | EDL96493.1 | 320 | acyl-CoA thioesterase 8, isoform CRA_a [Rattus norvegicus] |
| GI:254587964 | RefSeq | NP_570112.3 | 374 | acyl-coenzyme A thioesterase 8 [Rattus norvegicus] |
| GI:254587964 | SwissProt | Q8VHK0.1 | 320 | RecName: Full=Acyl-coenzyme A thioesterase 8; Short=Acyl-CoA thioesterase 8; AltName: Full=Choloyl-coenzyme A thioesterase; AltName: Full=Peroxisomal acyl-CoA thioesterase 2; Short=PTE-2; AltName: Full=Peroxisomal acyl-coenzyme A thioester hydrolase 1; Short=PTE-1; AltName: Full=Peroxisomal long-chain acyl-CoA thioesterase 1 [Rattus norvegicus] |