Gene/Proteome Database (LMPD)

LMPD ID
LMP000275
Gene ID
Species
Mus musculus (Mouse)
Gene Name
alpha 1,4-galactosyltransferase
Gene Symbol
Synonyms
-
Chromosome
15
Map Location
15 E1|15
Summary
The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. The encoded protein, which is a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2010]
Orthologs

Proteins

lactosylceramide 4-alpha-galactosyltransferase
Refseq ID NP_001164425
Protein GI 283483963
UniProt ID Q3TRS1
mRNA ID NM_001170954
Length 359
RefSeq Status REVIEWED
MGISCSHLEETMSKPPDCLLRMLRGTPRQRVFTFFIISFKFMFLISILIYWHTVGAPKDQREYSLPVDFSCPQLAFPRVSAPGNIFFLETSDRTSPNFLFMCSVESAARAHPESQVVVLMKGLPRDTTAQPRNLGISLLSCFPNVWIRPLDLQELFEDTPLAAWYSEARHRWEPYQLPVLSDASRIALLWKFGGIYLDTDFIVLKNLLNLTNTLGIQSRYVLNGAFLAFERKHEFLALCLHDFVANYNGWIWGHQGPQLLTRVFKKWCSIQSLEKSHACRGVTALPPEAFYPIPWQNWKKYFEDISPEELTQLLNATYAVHVWNKKSQGTHLEATSKALLAQLHARYCPTTHRAMKMYL
lactosylceramide 4-alpha-galactosyltransferase
Refseq ID NP_001004150
Protein GI 51921295
UniProt ID Q3UF00
mRNA ID NM_001004150
Length 359
RefSeq Status REVIEWED
Protein sequence is identical to GI:283483963 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
alpha 1,4-galactosyltransferase
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0050512 IDA:MGI F lactosylceramide 4-alpha-galactosyltransferase activity
GO:0015643 IMP:MGI F toxic substance binding
GO:0001576 IDA:MGI P globoside biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR007652 Alpha 1,4-glycosyltransferase domain
IPR007577 Glycosyltransferase, DXD sugar-binding motif
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
alpha 1,4-galactosyltransferase
Protein Entry
Q3UF00_MOUSE
UniProt ID
Species
Mouse

Identical and Related Proteins

Unique RefSeq proteins for LMP000275 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
283483963 RefSeq NP_001164425 359 lactosylceramide 4-alpha-galactosyltransferase

Identical Sequences to LMP000275 proteins

Reference Database Accession Length Protein Name
GI:283483963 DBBJ BAE28761.1 359 unnamed protein product [Mus musculus]
GI:283483963 GenBank EDL04477.1 359 alpha 1,4-galactosyltransferase [Mus musculus]
GI:283483963 GenBank AAI38846.1 359 Alpha 1,4-galactosyltransferase [Mus musculus]
GI:283483963 GenBank AAI38845.1 359 Alpha 1,4-galactosyltransferase [Mus musculus]
GI:283483963 RefSeq NP_001004150.1 359 lactosylceramide 4-alpha-galactosyltransferase [Mus musculus]
GI:283483963 SwissProt Q67BJ4.1 359 RecName: Full=Lactosylceramide 4-alpha-galactosyltransferase; AltName: Full=Alpha-1,4-N-acetylglucosaminyltransferase; AltName: Full=Alpha-1,4-galactosyltransferase; AltName: Full=Alpha4Gal-T1; AltName: Full=Globotriaosylceramide synthase; Short=Gb3 synthase; AltName: Full=UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase [Mus musculus]

Related Sequences to LMP000275 proteins

Reference Database Accession Length Protein Name
GI:283483963 DBBJ BAE36956.1 359 unnamed protein product [Mus musculus]
GI:283483963 GenBank AAF82758.1 360 Gb3 synthase [Rattus norvegicus]
GI:283483963 GenBank AAH97323.1 360 Alpha 1,4-galactosyltransferase [Rattus norvegicus]
GI:283483963 GenBank ABA25853.1 348 alpha-1,4-galactosyltransferase [Mus musculus]
GI:283483963 GenBank EDM15634.1 360 alpha 1,4-galactosyltransferase, isoform CRA_a [Rattus norvegicus]
GI:283483963 GenBank EDM15635.1 360 alpha 1,4-galactosyltransferase, isoform CRA_a [Rattus norvegicus]