Gene/Proteome Database (LMPD)

LMPD ID
LMP000295
Gene ID
18778
Species
Mus musculus (Mouse)
Gene Name
phospholipase A2, group IB, pancreas
Gene Symbol
Pla2g1b
Synonyms
Pla2a; sPLA2IB
Alternate Names
phospholipase A2; PLA2-Ib; group IB phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B
Chromosome
5
Map Location
5|5 F1-G1.1
EC Number
3.1.1.4

Proteins

phospholipase A2 precursor
Refseq ID NP_035237
Protein GI 6755090
UniProt ID Q9Z0Y2
mRNA ID NM_011107
Length 146
RefSeq Status PROVISIONAL
MKLLLLAALLTAGAAAHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFC
sig_peptide: 1..15 inference: non-experimental evidence, no additional details recorded note: By similarity; propagated from UniProtKB/Swiss-Prot (Q9Z0Y2.1) calculated_mol_wt: 1470 peptide sequence: MKLLLLAALLTAGAA mat_peptide: 23..146 product: Phospholipase A2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9Z0Y2.1) calculated_mol_wt: 14089 peptide sequence: AVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFC

Gene Information

Entrez Gene ID
18778
Gene Name
phospholipase A2, group IB, pancreas
Gene Symbol
Pla2g1b
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009986 IEA:Ensembl C cell surface
GO:0005576 IDA:MGI C extracellular region
GO:0005615 IEA:Ensembl C extracellular space
GO:0030141 IEA:Ensembl C secretory granule
GO:0047498 IEA:Ensembl F calcium-dependent phospholipase A2 activity
GO:0005509 IEA:InterPro F calcium ion binding
GO:0004623 IDA:MGI F phospholipase A2 activity
GO:0005102 IDA:MGI F receptor binding
GO:0019731 IEA:Ensembl P antibacterial humoral response
GO:0050830 IEA:Ensembl P defense response to Gram-positive bacterium
GO:0006633 IEA:Ensembl P fatty acid biosynthetic process
GO:0002227 IEA:Ensembl P innate immune response in mucosa
GO:0044240 IEA:Ensembl P multicellular organismal lipid catabolic process
GO:0046470 IEA:Ensembl P phosphatidylcholine metabolic process
GO:0009395 TAS:MGI P phospholipid catabolic process
GO:0045740 IEA:Ensembl P positive regulation of DNA replication

KEGG Pathway Links

KEGG Pathway ID Description
mmu04975 Fat digestion and absorption
mmu04972 Pancreatic secretion
mmu04014 Ras signaling pathway
mmu04270 Vascular smooth muscle contraction

Domain Information

InterPro Annotations

Accession Description
IPR001211 Phospholipase A2
IPR013090 Phospholipase A2, active site
IPR016090 Phospholipase A2 domain

UniProt Annotations

Entry Information

Gene Name
phospholipase A2, group IB, pancreas
Protein Entry
PA21B_MOUSE
UniProt ID
Q9Z0Y2
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO:0000255|PROSITE- ProRule:PRU10035, ECO:0000255|PROSITE-ProRule:PRU10036}.
Cofactor Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000250}; Note=Binds 1 Ca(2+) ion per subunit. {ECO:0000250};
Function PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides, this releases glycerophospholipids and arachidonic acid that serve as the precursors of signal molecules.
Ptm Activated by trypsin cleavage in the duodenum. Can also be activated by thrombin or autocatalytically (By similarity). {ECO:0000250}.
Similarity Belongs to the phospholipase A2 family. {ECO:0000305}.
Subcellular Location Secreted. Note=secreted from pancreatic acinar cells in its inactive form. {ECO:0000250}.
Subunit Monomer or homodimer. The inactive pro-form is a homotrimer (By similarity). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000295 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6755090 RefSeq NP_035237 146 phospholipase A2 precursor

Identical Sequences to LMP000295 proteins

Reference Database Accession Length Protein Name
GI:6755090 DBBJ BAC25763.1 146 unnamed protein product [Mus musculus]
GI:6755090 GenBank EDL19858.1 146 phospholipase A2, group IB, pancreas [Mus musculus]
GI:6755090 GenBank AAI45909.1 146 Phospholipase A2, group IB, pancreas [Mus musculus]
GI:6755090 GenBank AAI45911.1 146 Phospholipase A2, group IB, pancreas [Mus musculus]
GI:6755090 GenBank AEU43301.1 146 Sequence 50 from patent US 8052970
GI:6755090 RefSeq XP_006530261.1 146 PREDICTED: phospholipase A2 isoform X1 [Mus musculus]

Related Sequences to LMP000295 proteins

Reference Database Accession Length Protein Name
GI:6755090 DBBJ BAB25608.1 146 unnamed protein product [Mus musculus]
GI:6755090 DBBJ BAB26212.1 146 unnamed protein product [Mus musculus]
GI:6755090 GenBank AAE33227.1 146 Sequence 34 from patent US 5972677
GI:6755090 GenBank EDM13879.1 146 phospholipase A2, group IB, isoform CRA_b [Rattus norvegicus]
GI:6755090 GenBank AEU43283.1 146 Sequence 32 from patent US 8052970
GI:6755090 RefSeq XP_006530262.1 145 PREDICTED: phospholipase A2 isoform X2 [Mus musculus]