Gene/Proteome Database (LMPD)

LMPD ID
LMP000320
Gene ID
67800
Species
Mus musculus (Mouse)
Gene Name
diacylglycerol O-acyltransferase 2
Gene Symbol
Dgat2
Synonyms
0610010B06Rik; ARAT; DGAT-2
Alternate Names
diacylglycerol O-acyltransferase 2; diglyceride acyltransferase 2; retinol O-fatty-acyltransferase; diacylglycerol acyltransferase 2; acyl-CoA retinol O-fatty-acyltransferase
Chromosome
7
Map Location
7|7 F1
EC Number
2.3.1.20

Proteins

diacylglycerol O-acyltransferase 2
Refseq ID NP_080660
Protein GI 16975490
UniProt ID Q9DCV3
mRNA ID NM_026384
Length 388
RefSeq Status PROVISIONAL
MKTLIAAYSGVLRGERRAEAARSENKNKGSALSREGSGRWGTGSSILSALQDIFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSVILMYTFCTDCWLIAVLYFTWLAFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLKNRKGFVKLALRHGADLVPTYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITVPKLEHPTQKDIDLYHAMYMEALVKLFDNHKTKFGLPETEVLEVN

Gene Information

Entrez Gene ID
67800
Gene Name
diacylglycerol O-acyltransferase 2
Gene Symbol
Dgat2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:BHF-UCL C endoplasmic reticulum
GO:0030176 IDA:BHF-UCL C integral component of endoplasmic reticulum membrane
GO:0016021 IDA:MGI C integral component of membrane
GO:0005811 IEA:UniProtKB-KW C lipid particle
GO:0016020 IDA:MGI C membrane
GO:0048471 IDA:BHF-UCL C perinuclear region of cytoplasm
GO:0003846 IDA:MGI F 2-acylglycerol O-acyltransferase activity
GO:0004144 ISS:UniProtKB F diacylglycerol O-acyltransferase activity
GO:0042803 IPI:BHF-UCL F protein homodimerization activity
GO:0050252 IEA:UniProtKB-EC F retinol O-fatty-acyltransferase activity
GO:0071400 IMP:BHF-UCL P cellular response to oleic acid
GO:0035356 IMP:BHF-UCL P cellular triglyceride homeostasis
GO:0042632 IMP:BHF-UCL P cholesterol homeostasis
GO:0046339 IDA:BHF-UCL P diacylglycerol metabolic process
GO:0060613 IMP:BHF-UCL P fat pad development
GO:0055089 IGI:BHF-UCL P fatty acid homeostasis
GO:0006071 IEA:UniProtKB-KW P glycerol metabolic process
GO:0019915 IMP:BHF-UCL P lipid storage
GO:0035336 IDA:BHF-UCL P long-chain fatty-acyl-CoA metabolic process
GO:0034383 IMP:BHF-UCL P low-density lipoprotein particle clearance
GO:0097006 IMP:BHF-UCL P regulation of plasma lipoprotein particle levels
GO:0019432 ISS:UniProtKB P triglyceride biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu04975 Fat digestion and absorption
mmu00561 Glycerolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5893976 Acyl chain remodeling of DAG and TAG

Domain Information

InterPro Annotations

Accession Description
IPR007130 Diacylglycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
diacylglycerol O-acyltransferase 2
Protein Entry
DGAT2_MOUSE
UniProt ID
Q9DCV3
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.
Catalytic Activity Acyl-CoA + retinol = CoA + retinyl ester.
Disruption Phenotype Mice are lipopenic and die soon after birth, apparently from profound reductions in substrates for energy metabolism and from impaired permeability barrier function in the skin. {ECO:0000269|PubMed:14668353}.
Enzyme Regulation Inhibited by niacin. {ECO:0000250}.
Function Essential acyltransferase that catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for synthesis and storage of intracellular triglycerides. Probably plays a central role in cytosolic lipid accumulation. In liver, is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides. Functions also as an acyl-CoA retinol acyltransferase (ARAT) (By similarity). {ECO:0000250}.
Induction In white adipose tissue, it is regulated by leptin. By insulin. Up-regulated in diabetic mice. Down-regulated upon fasting and replenished upon refeeding in adipose tissue and liver. Down-regulation in obese animals can reduce hepatic lipogenesis and hepatic steatosis as well as attenuate hyperlipidemia, thereby leading to an improvement in metabolic syndrome. {ECO:0000269|PubMed:12413942, ECO:0000269|PubMed:14521909, ECO:0000269|PubMed:16001399}.
Pathway Glycerolipid metabolism; triacylglycerol biosynthesis.
Similarity Belongs to the diacylglycerol acyltransferase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Lipid droplet {ECO:0000250}.
Subunit Forms multimeric complexes consisting of several DGAT2 subunits. {ECO:0000250}.
Tissue Specificity Predominantly expressed in liver. Also expressed in testis. {ECO:0000269|PubMed:11481335}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000320 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16975490 RefSeq NP_080660 388 diacylglycerol O-acyltransferase 2

Identical Sequences to LMP000320 proteins

Reference Database Accession Length Protein Name
GI:16975490 GenBank ADR90376.1 388 Sequence 98 from patent US 7741532
GI:16975490 GenBank ADR90382.1 388 Sequence 127 from patent US 7741532
GI:16975490 GenBank AED72408.1 388 Sequence 12 from patent US 7910346
GI:16975490 GenBank AGC98167.1 388 Sequence 12 from patent US 8334111
GI:16975490 GenBank AGX59587.1 388 Sequence 19453 from patent US 8541208
GI:16975490 GenBank AGX72252.1 388 Sequence 44303 from patent US 8541208

Related Sequences to LMP000320 proteins

Reference Database Accession Length Protein Name
GI:16975490 GenBank AAH89846.1 388 Diacylglycerol O-acyltransferase homolog 2 (mouse) [Rattus norvegicus]
GI:16975490 RefSeq NP_001012345.1 388 diacylglycerol O-acyltransferase 2 [Rattus norvegicus]
GI:16975490 RefSeq XP_003507132.1 388 PREDICTED: diacylglycerol O-acyltransferase 2 isoform X1 [Cricetulus griseus]
GI:16975490 RefSeq XP_006982228.1 388 PREDICTED: diacylglycerol O-acyltransferase 2 isoform X1 [Peromyscus maniculatus bairdii]
GI:16975490 RefSeq XP_006982230.1 388 PREDICTED: diacylglycerol O-acyltransferase 2 isoform X3 [Peromyscus maniculatus bairdii]
GI:16975490 SwissProt Q5FVP8.1 388 RecName: Full=Diacylglycerol O-acyltransferase 2; AltName: Full=Acyl-CoA retinol O-fatty-acyltransferase; Short=ARAT; Short=Retinol O-fatty-acyltransferase; AltName: Full=Diglyceride acyltransferase 2 [Rattus norvegicus]