Gene/Proteome Database (LMPD)

LMPD ID
LMP000328
Gene ID
20280
Species
Mus musculus (Mouse)
Gene Name
sterol carrier protein 2, liver
Gene Symbol
Scp2
Synonyms
AA409774; AA409893; C76618; C79031; NSL-TP; SCP-2; SCP-X; SCPX; ns-LTP
Alternate Names
non-specific lipid-transfer protein; SCP-chi; sterol carrier protein X; propanoyl-CoA C-acyltransferase; nonspecific lipid transfer protein
Chromosome
4
Map Location
4 C7|4 50.2 cM
EC Number
2.3.1.176

Proteins

non-specific lipid-transfer protein
Refseq ID NP_035457
Protein GI 45476581
UniProt ID P32020
mRNA ID NM_011327
Length 547
RefSeq Status VALIDATED
MPSVALKSPRLRRVFVVGVGMTKFMKPGGENSRDYPDMAKEAGQKALEDAQIPYSAVEQACVGYVYGDSTSGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMAHQLIQGGLANCVLALGFEKMERGSIGTKFSDRTTPTDKHIEVLIDKYGLSAHPITPQMFGYAGKEHMEKYGTKVEHFAKIGWKNHKHSVNNTYSQFQDEYSLEEVMKSKPVFDFLTILQCCPTSDGAAAAILSSEEFVQQYGLQSKAVEIVAQEMMTDLPSTFEEKSIIKVVGYDMSKEAARRCYEKSGLTPNDVDVIELHDCFSVNELITYEALGLCPEGQGGTLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGLGGAVVVTLYRMGFPEAASSFRTHQVSAAPTSSAGDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQNLQLQPGKAKL

Gene Information

Entrez Gene ID
20280
Gene Name
sterol carrier protein 2, liver
Gene Symbol
Scp2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005739 IDA:MGI C mitochondrion
GO:0005634 IEA:Ensembl C nucleus
GO:0005777 TAS:MGI C peroxisome
GO:0043234 IEA:Ensembl C protein complex
GO:0015485 IEA:Ensembl F cholesterol binding
GO:0036042 IEA:Ensembl F long-chain fatty acyl-CoA binding
GO:0070538 IEA:Ensembl F oleic acid binding
GO:0008526 IEA:Ensembl F phosphatidylinositol transporter activity
GO:0033814 IEA:UniProtKB-EC F propanoyl-CoA C-acyltransferase activity
GO:0050632 TAS:MGI F propionyl-CoA C2-trimethyltridecanoyltransferase activity
GO:0006637 TAS:MGI P acyl-CoA metabolic process
GO:0032959 IEA:Ensembl P inositol trisphosphate biosynthetic process
GO:1901373 IEA:Ensembl P lipid hydroperoxide transport
GO:0007031 IMP:MGI P peroxisome organization
GO:0032385 IEA:Ensembl P positive regulation of intracellular cholesterol transport
GO:0045940 IEA:Ensembl P positive regulation of steroid metabolic process
GO:0006701 IEA:Ensembl P progesterone biosynthetic process
GO:0072659 IEA:Ensembl P protein localization to plasma membrane

KEGG Pathway Links

KEGG Pathway ID Description
mmu03320 PPAR signaling pathway
mmu04146 Peroxisome
mmu00120 Primary bile acid biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR003033 SCP2 sterol-binding domain
IPR020617 Thiolase, C-terminal
IPR020616 Thiolase, N-terminal
IPR020615 Thiolase, acyl-enzyme intermediate active site
IPR020613 Thiolase, conserved site
IPR016039 Thiolase-like
IPR016038 Thiolase-like, subgroup

UniProt Annotations

Entry Information

Gene Name
sterol carrier protein 2, liver
Protein Entry
NLTP_MOUSE
UniProt ID
P32020
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative initiation; Named isoforms=2; Name=SCPx; IsoId=P32020-1; Sequence=Displayed; Name=SCP2; IsoId=P32020-2; Sequence=VSP_018895; Note=Mitochondrial precursor. Contains a mitochondrial transit peptide at positions 405-424 (Potential). {ECO:0000305};
Catalytic Activity 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta- cholanoyl-CoA + propanoyl-CoA = CoA + 3-alpha,7-alpha,12-alpha- trihydroxy-24-oxo-5-beta-cholestanoyl-CoA.
Function Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.
Similarity Contains 1 SCP2 domain. {ECO:0000305}.
Similarity In the N-terminal section; belongs to the thiolase family. {ECO:0000305}.
Subcellular Location Cytoplasm. Note=Cytoplasmic in the liver and also associated with mitochondria especially in steroidogenic tissues.
Subcellular Location Isoform SCP2: Mitochondrion.
Subcellular Location Isoform SCPx: Peroxisome. Note=Interaction with PEX5 is essential for peroxisomal import. {ECO:0000250}.
Subunit Interacts with PEX5. {ECO:0000250}.
Tissue Specificity Present at low levels in all tissues examined but expressed predominantly in the liver.

Identical and Related Proteins

Unique RefSeq proteins for LMP000328 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
45476581 RefSeq NP_035457 547 non-specific lipid-transfer protein

Identical Sequences to LMP000328 proteins

Reference Database Accession Length Protein Name
GI:45476581 GenBank AAH18384.1 547 Sterol carrier protein 2, liver [Mus musculus]
GI:45476581 GenBank AAH34613.1 547 Sterol carrier protein 2, liver [Mus musculus]
GI:45476581 SwissProt P32020.3 547 RecName: Full=Non-specific lipid-transfer protein; Short=NSL-TP; AltName: Full=Propanoyl-CoA C-acyltransferase; AltName: Full=SCP-chi; AltName: Full=SCPX; AltName: Full=Sterol carrier protein 2; Short=SCP-2; AltName: Full=Sterol carrier protein X; Short=SCP-X [Mus musculus]

Related Sequences to LMP000328 proteins

Reference Database Accession Length Protein Name
GI:45476581 GenBank AAA40098.1 547 sterol-carrier protein X [Mus musculus]
GI:45476581 GenBank EDL30752.1 534 mCG126417, isoform CRA_a [Mus musculus]
GI:45476581 GenBank EDL30755.1 531 mCG126417, isoform CRA_d [Mus musculus]
GI:45476581 GenBank EGV97950.1 547 Non-specific lipid-transfer protein [Cricetulus griseus]
GI:45476581 RefSeq XP_003496559.1 547 PREDICTED: non-specific lipid-transfer protein [Cricetulus griseus]
GI:45476581 RefSeq XP_007611057.1 547 PREDICTED: non-specific lipid-transfer protein [Cricetulus griseus]