Gene/Proteome Database (LMPD)
LMPD ID
LMP000342
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)
Gene Symbol
Synonyms
1810041M08Rik
Alternate Names
ATP synthase F(0) complex subunit C2, mitochondrial; ATPase protein 9; ATPase subunit c; ATP synthase proteolipid P2; ATP synthase lipid-binding protein, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2
Chromosome
15
Map Location
15 F3|15
Proteins
| ATP synthase F(0) complex subunit C2, mitochondrial precursor | |
|---|---|
| Refseq ID | NP_080744 |
| Protein GI | 13385960 |
| UniProt ID | P56383 |
| mRNA ID | NM_026468 |
| Length | 146 |
| RefSeq Status | PROVISIONAL |
| MYACSKFVSTRSLIRSTSLRSTSQLLSRPLSAVELKRPQMPTDESLSSLAVRRPLTSLIPSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
| transit_peptide: 1..71 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (P56383.2) calculated_mol_wt: 7886 peptide sequence: MYACSKFVSTRSLIRSTSLRSTSQLLSRPLSAVELKRPQMPTDESLSSLAVRRPLTSLIPSRSFQTSAISR mat_peptide: 72..146 product: ATP synthase F(0) complex subunit C2, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P56383.2) calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
Gene Information
Entrez Gene ID
Gene Name
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
| GO:0045263 | IEA:UniProtKB-KW | C | proton-transporting ATP synthase complex, coupling factor F(o) |
| GO:0015078 | IEA:InterPro | F | hydrogen ion transmembrane transporter activity |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0015991 | IEA:InterPro | P | ATP hydrolysis coupled proton transport |
| GO:0015986 | IEA:InterPro | P | ATP synthesis coupled proton transport |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)
Protein Entry
AT5G2_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Disease | Note=This protein is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease). |
| Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. |
| Miscellaneous | There are three genes which encode the mitochondrial ATP synthase proteolipid and they specify precursors with different import sequences but identical mature proteins. {ECO:0000305}. |
| Similarity | Belongs to the ATPase C chain family. {ECO:0000305}. |
| Subcellular Location | Mitochondrion membrane; Multi-pass membrane protein. |
| Subunit | F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000342 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13385960 | RefSeq | NP_080744 | 146 | ATP synthase F(0) complex subunit C2, mitochondrial precursor |
Identical Sequences to LMP000342 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13385960 | GenBank | AAH81437.1 | 146 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] |
| GI:13385960 | GenBank | AAI06139.1 | 146 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] |
| GI:13385960 | GenBank | EDL01662.1 | 146 | mCG118574 [Mus musculus] |
| GI:13385960 | GenBank | EDL03957.1 | 146 | mCG17597 [Mus musculus] |
| GI:13385960 | GenBank | EDL24364.1 | 146 | mCG113310 [Mus musculus] |
| GI:13385960 | SwissProt | P56383.2 | 146 | RecName: Full=ATP synthase F(0) complex subunit C2, mitochondrial; AltName: Full=ATP synthase lipid-binding protein; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor [Mus musculus] |
Related Sequences to LMP000342 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13385960 | GenBank | AAI28727.1 | 141 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Rattus norvegicus] |
| GI:13385960 | GenBank | EDL04287.1 | 146 | mCG19742 [Mus musculus] |
| GI:13385960 | GenBank | EDL86816.1 | 141 | rCG50567, isoform CRA_a [Rattus norvegicus] |
| GI:13385960 | RefSeq | NP_598240.1 | 141 | ATP synthase F(0) complex subunit C2, mitochondrial precursor [Rattus norvegicus] |
| GI:13385960 | RefSeq | XP_006521364.1 | 190 | PREDICTED: ATP synthase F(0) complex subunit C2, mitochondrial isoform X1 [Mus musculus] |
| GI:13385960 | SwissProt | Q06646.1 | 141 | RecName: Full=ATP synthase F(0) complex subunit C2, mitochondrial; AltName: Full=ATP synthase lipid-binding protein; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor [Rattus norvegicus] |