Gene/Proteome Database (LMPD)

LMPD ID
LMP000368
Gene ID
80765
Species
Homo sapiens (Human)
Gene Name
StAR-related lipid transfer (START) domain containing 5
Gene Symbol
STARD5
Synonyms
-
Alternate Names
stAR-related lipid transfer protein 5; START domain containing 5; START domain-containing protein 5
Chromosome
15
Map Location
15q26
Summary
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD5 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM, Mar 2008]
Orthologs
View orthologs and multiple alignments for STARD5

Proteins

stAR-related lipid transfer protein 5
Refseq ID NP_871629
Protein GI 32526915
UniProt ID Q9NSY2
mRNA ID NM_181900
Length 213
RefSeq Status VALIDATED
MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE

Gene Information

Entrez Gene ID
80765
Gene Name
StAR-related lipid transfer (START) domain containing 5
Gene Symbol
STARD5
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:Reactome C cytosol
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006700 TAS:Reactome P C21-steroid hormone biosynthetic process
GO:0006869 IEA:UniProtKB-KW P lipid transport
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0008202 TAS:Reactome P steroid metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_111217 Metabolism
REACT_22258 Metabolism of lipids and lipoproteins
REACT_11057 Metabolism of steroid hormones and vitamin D
REACT_11038 Pregnenolone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR023393 START-like domain
IPR002913 START_lipid-bd_dom

UniProt Annotations

Entry Information

Gene Name
StAR-related lipid transfer (START) domain containing 5
Protein Entry
STAR5_HUMAN
UniProt ID
Q9NSY2
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NSY2-1; Sequence=Displayed; Name=2; IsoId=Q9NSY2-3; Sequence=VSP_014871, VSP_014872; Note=No experimental confirmation available.;
Function May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols (By similarity).
Similarity Contains 1 START domain. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP000368 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
32526915 RefSeq NP_871629 213 stAR-related lipid transfer protein 5

Identical Sequences to LMP000368 proteins

Reference Database Accession Length Protein Name
GI:32526915 GenBank AAH04365.2 213 StAR-related lipid transfer (START) domain containing 5 [Homo sapiens]
GI:32526915 GenBank EAW99097.1 213 START domain containing 5, isoform CRA_c [Homo sapiens]
GI:32526915 GenBank AFO06892.1 213 Sequence 23 from patent US 8221999
GI:32526915 GenBank AHD79680.1 213 Sequence 29324 from patent US 8586006
GI:32526915 GenBank AIC52409.1 213 STARD5, partial [synthetic construct]
GI:32526915 RefSeq XP_004056708.1 213 PREDICTED: stAR-related lipid transfer protein 5 [Gorilla gorilla gorilla]

Related Sequences to LMP000368 proteins

Reference Database Accession Length Protein Name
GI:32526915 EMBL CAH91861.1 213 hypothetical protein [Pongo abelii]
GI:32526915 GenBank JAA09825.1 213 StAR-related lipid transfer (START) domain containing 5 [Pan troglodytes]
GI:32526915 GenBank JAA19500.1 213 StAR-related lipid transfer (START) domain containing 5 [Pan troglodytes]
GI:32526915 RefSeq NP_001126078.1 213 stAR-related lipid transfer protein 5 [Pongo abelii]
GI:32526915 RefSeq XP_009248370.1 213 PREDICTED: stAR-related lipid transfer protein 5 isoform X1 [Pongo abelii]
GI:32526915 SwissProt Q5R8P9.1 213 RecName: Full=StAR-related lipid transfer protein 5; AltName: Full=START domain-containing protein 5; Short=StARD5 [Pongo abelii]