Gene/Proteome Database (LMPD)
LMPD ID
LMP000368
Gene ID
Species
Homo sapiens (Human)
Gene Name
StAR-related lipid transfer (START) domain containing 5
Gene Symbol
Synonyms
-
Alternate Names
stAR-related lipid transfer protein 5; START domain containing 5; START domain-containing protein 5
Chromosome
15
Map Location
15q26
Summary
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD5 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
| stAR-related lipid transfer protein 5 | |
|---|---|
| Refseq ID | NP_871629 |
| Protein GI | 32526915 |
| UniProt ID | Q9NSY2 |
| mRNA ID | NM_181900 |
| Length | 213 |
| RefSeq Status | VALIDATED |
| MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE | |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 5
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0006700 | TAS:Reactome | P | C21-steroid hormone biosynthetic process |
| GO:0006869 | IEA:UniProtKB-KW | P | lipid transport |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0008202 | TAS:Reactome | P | steroid metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_111217 | Metabolism |
| REACT_22258 | Metabolism of lipids and lipoproteins |
| REACT_11057 | Metabolism of steroid hormones and vitamin D |
| REACT_11038 | Pregnenolone biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 5
Protein Entry
STAR5_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NSY2-1; Sequence=Displayed; Name=2; IsoId=Q9NSY2-3; Sequence=VSP_014871, VSP_014872; Note=No experimental confirmation available.; |
| Function | May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols (By similarity). |
| Similarity | Contains 1 START domain. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP000368 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 32526915 | RefSeq | NP_871629 | 213 | stAR-related lipid transfer protein 5 |
Identical Sequences to LMP000368 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:32526915 | GenBank | AAH04365.2 | 213 | StAR-related lipid transfer (START) domain containing 5 [Homo sapiens] |
| GI:32526915 | GenBank | EAW99097.1 | 213 | START domain containing 5, isoform CRA_c [Homo sapiens] |
| GI:32526915 | GenBank | AFO06892.1 | 213 | Sequence 23 from patent US 8221999 |
| GI:32526915 | GenBank | AHD79680.1 | 213 | Sequence 29324 from patent US 8586006 |
| GI:32526915 | GenBank | AIC52409.1 | 213 | STARD5, partial [synthetic construct] |
| GI:32526915 | RefSeq | XP_004056708.1 | 213 | PREDICTED: stAR-related lipid transfer protein 5 [Gorilla gorilla gorilla] |
Related Sequences to LMP000368 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:32526915 | EMBL | CAH91861.1 | 213 | hypothetical protein [Pongo abelii] |
| GI:32526915 | GenBank | JAA09825.1 | 213 | StAR-related lipid transfer (START) domain containing 5 [Pan troglodytes] |
| GI:32526915 | GenBank | JAA19500.1 | 213 | StAR-related lipid transfer (START) domain containing 5 [Pan troglodytes] |
| GI:32526915 | RefSeq | NP_001126078.1 | 213 | stAR-related lipid transfer protein 5 [Pongo abelii] |
| GI:32526915 | RefSeq | XP_009248370.1 | 213 | PREDICTED: stAR-related lipid transfer protein 5 isoform X1 [Pongo abelii] |
| GI:32526915 | SwissProt | Q5R8P9.1 | 213 | RecName: Full=StAR-related lipid transfer protein 5; AltName: Full=START domain-containing protein 5; Short=StARD5 [Pongo abelii] |