Gene/Proteome Database (LMPD)
LMPD ID
LMP000432
Gene ID
Species
Mus musculus (Mouse)
Gene Name
Fc receptor, IgE, high affinity I, alpha polypeptide
Gene Symbol
Synonyms
FcERI; Fce1a; Fcr-5; fcepsilonri
Alternate Names
high affinity immunoglobulin epsilon receptor subunit alpha; fc-epsilon RI-alpha; igE Fc receptor subunit alpha
Chromosome
1
Map Location
1 H3|1 80.33 cM
Proteins
high affinity immunoglobulin epsilon receptor subunit alpha precursor | |
---|---|
Refseq ID | NP_034314 |
Protein GI | 226823365 |
UniProt ID | P20489 |
mRNA ID | NM_010184 |
Length | 250 |
RefSeq Status | VALIDATED |
MVTGRSAQLCLALLFMSLDVILTATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT | |
sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2496 peptide sequence: MVTGRSAQLCLALLFMSLDVILT mat_peptide: 24..250 product: High affinity immunoglobulin epsilon receptor subunit alpha experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P20489.2) calculated_mol_wt: 26179 peptide sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT |
Gene Information
Entrez Gene ID
Gene Name
Fc receptor, IgE, high affinity I, alpha polypeptide
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009897 | IDA:MGI | C | external side of plasma membrane |
GO:0005887 | IDA:MGI | C | integral component of plasma membrane |
GO:0045121 | TAS:MGI | C | membrane raft |
GO:0019863 | IDA:MGI | F | IgE binding |
GO:0019767 | IDA:MGI | F | IgE receptor activity |
GO:0007257 | IDA:MGI | P | activation of JUN kinase activity |
GO:0000187 | IDA:MGI | P | activation of MAPK activity |
GO:0007166 | IDA:MGI | P | cell surface receptor signaling pathway |
GO:0038095 | IDA:GOC | P | Fc-epsilon receptor signaling pathway |
GO:0019370 | IDA:MGI | P | leukotriene biosynthetic process |
GO:0050850 | IDA:MGI | P | positive regulation of calcium-mediated signaling |
GO:0045425 | IDA:MGI | P | positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process |
GO:0045401 | IDA:MGI | P | positive regulation of interleukin-3 biosynthetic process |
GO:0043306 | IDA:MGI | P | positive regulation of mast cell degranulation |
GO:0050731 | IDA:MGI | P | positive regulation of peptidyl-tyrosine phosphorylation |
GO:0001812 | IMP:MGI | P | positive regulation of type I hypersensitivity |
GO:0001820 | IDA:MGI | P | serotonin secretion |
GO:0007165 | IDA:MGI | P | signal transduction |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
Fc receptor, IgE, high affinity I, alpha polypeptide
Protein Entry
FCERA_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines. |
Induction | Exhibits night/day variations with an increased expression at night in the pineal gland. {ECO:0000269|PubMed:17728245}. |
Similarity | Contains 2 Ig-like (immunoglobulin-like) domains. {ECO:0000305}. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Subunit | Tetramer of an alpha chain, a beta chain, and two disulfide linked gamma chains. |
Tissue Specificity | Expressed in bone marrow mast cells, as well as in the pineal gland at night. {ECO:0000269|PubMed:17728245}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000432 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
226823365 | RefSeq | NP_034314 | 250 | high affinity immunoglobulin epsilon receptor subunit alpha precursor |
Identical Sequences to LMP000432 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:226823365 | SwissProt | P20489.2 | 250 | RecName: Full=High affinity immunoglobulin epsilon receptor subunit alpha; AltName: Full=Fc-epsilon RI-alpha; Short=FcERI; AltName: Full=IgE Fc receptor subunit alpha; Flags: Precursor [Mus musculus] |
Related Sequences to LMP000432 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:226823365 | GenBank | AAA37600.1 | 250 | high affinity IgE receptor alpha subunit precursor [Mus musculus] |
GI:226823365 | GenBank | AAE57180.1 | 227 | Sequence 14 from patent US 6171803 |
GI:226823365 | GenBank | AAI25456.1 | 250 | Fc receptor, IgE, high affinity I, alpha polypeptide [Mus musculus] |
GI:226823365 | GenBank | AAI25458.1 | 250 | Fc receptor, IgE, high affinity I, alpha polypeptide [Mus musculus] |
GI:226823365 | GenBank | EDL38996.1 | 250 | Fc receptor, IgE, high affinity I, alpha polypeptide [Mus musculus] |
GI:226823365 | RefSeq | XP_006496718.1 | 243 | PREDICTED: high affinity immunoglobulin epsilon receptor subunit alpha isoform X1 [Mus musculus] |