Gene/Proteome Database (LMPD)

LMPD ID
LMP000432
Gene ID
14125
Species
Mus musculus (Mouse)
Gene Name
Fc receptor, IgE, high affinity I, alpha polypeptide
Gene Symbol
Fcer1a
Synonyms
FcERI; Fce1a; Fcr-5; fcepsilonri
Alternate Names
high affinity immunoglobulin epsilon receptor subunit alpha; fc-epsilon RI-alpha; igE Fc receptor subunit alpha
Chromosome
1
Map Location
1 H3|1 80.33 cM

Proteins

high affinity immunoglobulin epsilon receptor subunit alpha precursor
Refseq ID NP_034314
Protein GI 226823365
UniProt ID P20489
mRNA ID NM_010184
Length 250
RefSeq Status VALIDATED
MVTGRSAQLCLALLFMSLDVILTATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT
sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2496 peptide sequence: MVTGRSAQLCLALLFMSLDVILT mat_peptide: 24..250 product: High affinity immunoglobulin epsilon receptor subunit alpha experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P20489.2) calculated_mol_wt: 26179 peptide sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT

Gene Information

Entrez Gene ID
14125
Gene Name
Fc receptor, IgE, high affinity I, alpha polypeptide
Gene Symbol
Fcer1a
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009897 IDA:MGI C external side of plasma membrane
GO:0005887 IDA:MGI C integral component of plasma membrane
GO:0045121 TAS:MGI C membrane raft
GO:0019863 IDA:MGI F IgE binding
GO:0019767 IDA:MGI F IgE receptor activity
GO:0038095 IDA:GOC P Fc-epsilon receptor signaling pathway
GO:0007257 IDA:MGI P activation of JUN kinase activity
GO:0000187 IDA:MGI P activation of MAPK activity
GO:0007166 IDA:MGI P cell surface receptor signaling pathway
GO:0019370 IDA:MGI P leukotriene biosynthetic process
GO:0050850 IDA:MGI P positive regulation of calcium-mediated signaling
GO:0045425 IDA:MGI P positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process
GO:0045401 IDA:MGI P positive regulation of interleukin-3 biosynthetic process
GO:0043306 IDA:MGI P positive regulation of mast cell degranulation
GO:0050731 IDA:MGI P positive regulation of peptidyl-tyrosine phosphorylation
GO:0001812 IMP:MGI P positive regulation of type I hypersensitivity
GO:0001820 IDA:MGI P serotonin secretion
GO:0007165 IDA:MGI P signal transduction

KEGG Pathway Links

KEGG Pathway ID Description
ko05310 Asthma
mmu05310 Asthma
ko04664 Fc epsilon RI signaling pathway
mmu04664 Fc epsilon RI signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR003599 Immunoglobulin subtype
IPR007110 Immunoglobulin-like domain
IPR013783 Immunoglobulin-like fold

UniProt Annotations

Entry Information

Gene Name
Fc receptor, IgE, high affinity I, alpha polypeptide
Protein Entry
FCERA_MOUSE
UniProt ID
P20489
Species
Mouse

Comments

Comment Type Description
Function Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Induction Exhibits night/day variations with an increased expression at night in the pineal gland. {ECO:0000269|PubMed:17728245}.
Similarity Contains 2 Ig-like (immunoglobulin-like) domains. {ECO:0000305}.
Subcellular Location Cell membrane; Single-pass type I membrane protein.
Subunit Tetramer of an alpha chain, a beta chain, and two disulfide linked gamma chains.
Tissue Specificity Expressed in bone marrow mast cells, as well as in the pineal gland at night. {ECO:0000269|PubMed:17728245}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000432 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
226823365 RefSeq NP_034314 250 high affinity immunoglobulin epsilon receptor subunit alpha precursor

Identical Sequences to LMP000432 proteins

Reference Database Accession Length Protein Name
GI:226823365 SwissProt P20489.2 250 RecName: Full=High affinity immunoglobulin epsilon receptor subunit alpha; AltName: Full=Fc-epsilon RI-alpha; Short=FcERI; AltName: Full=IgE Fc receptor subunit alpha; Flags: Precursor [Mus musculus]

Related Sequences to LMP000432 proteins

Reference Database Accession Length Protein Name
GI:226823365 GenBank AAA37600.1 250 high affinity IgE receptor alpha subunit precursor [Mus musculus]
GI:226823365 GenBank AAE57180.1 227 Sequence 14 from patent US 6171803
GI:226823365 GenBank AAI25456.1 250 Fc receptor, IgE, high affinity I, alpha polypeptide [Mus musculus]
GI:226823365 GenBank AAI25458.1 250 Fc receptor, IgE, high affinity I, alpha polypeptide [Mus musculus]
GI:226823365 GenBank EDL38996.1 250 Fc receptor, IgE, high affinity I, alpha polypeptide [Mus musculus]
GI:226823365 RefSeq XP_006496718.1 243 PREDICTED: high affinity immunoglobulin epsilon receptor subunit alpha isoform X1 [Mus musculus]