Gene/Proteome Database (LMPD)
Proteins
arachidonate 15-lipoxygenase | |
---|---|
Refseq ID | NP_033790 |
Protein GI | 134948633 |
UniProt ID | P39654 |
mRNA ID | NM_009660 |
Length | 663 |
RefSeq Status | VALIDATED |
MGVYRIRVSTGDSVYAGSNNEVYLWLIGQHGEASLGKLFRPCRNSEAEFKVDVSEYLGPLLFVRVQKWHYLKEDAWFCNWISVKGPGDQGSEYTFPCYRWVQGTSILNLPEGTGCTVVEDSQGLFRNHREEELEERRSLYRWGNWKDGTILNVAATSISDLPVDQRFREDKRLEFEASQVLGTMDTVINFPKNTVTCWKSLDDFNYVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPMVLKRSTCLPARLVFPPGMEKLQAQLDEELKKGTLFEADFFLLDGIKANVILCSQQYLAAPLVMLKLQPDGQLLPIAIQLELPKTGSTPPPIFTPLDPPMDWLLAKCWVRSSDLQLHELQAHLLRGHLVAEVFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKVMSTGGGGHLDLLKQAGAFLTYSSLCPPDDLAERGLLDIDTCFYAKDALQLWQVMNRYVVGMFDLYYKTDQAVQDDYELQSWCQEITEIGLQGAQDRGFPTSLQSRAQACHFITMCIFTCTAQHSSIHLGQLDWFYWVPNAPCTMRLPPPKTKDATMEKLMATLPNPNQSTLQINVVWLLGRRQAVMVPLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSLVENSVAI |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IDA:MGI | C | cytoplasm |
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0031234 | IEA:Ensembl | C | extrinsic component of cytoplasmic side of plasma membrane |
GO:0005811 | IEA:Ensembl | C | lipid particle |
GO:0004052 | IEA:Ensembl | F | arachidonate 12-lipoxygenase activity |
GO:0050473 | IEA:Ensembl | F | arachidonate 15-lipoxygenase activity |
GO:0051120 | IEA:Ensembl | F | hepoxilin A3 synthase activity |
GO:0047977 | IEA:Ensembl | F | hepoxilin-epoxide hydrolase activity |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0005546 | IEA:Ensembl | F | phosphatidylinositol-4,5-bisphosphate binding |
GO:0019369 | IEA:Ensembl | P | arachidonic acid metabolic process |
GO:0030282 | IMP:MGI | P | bone mineralization |
GO:0071277 | IEA:Ensembl | P | cellular response to calcium ion |
GO:0035963 | IEA:Ensembl | P | cellular response to interleukin-13 |
GO:0051122 | IEA:Ensembl | P | hepoxilin biosynthetic process |
GO:0019372 | IEA:Ensembl | P | lipoxygenase pathway |
GO:0001503 | IMP:MGI | P | ossification |
GO:0010811 | IEA:Ensembl | P | positive regulation of cell-substrate adhesion |
GO:0070374 | IEA:Ensembl | P | positive regulation of ERK1 and ERK2 cascade |
GO:0034116 | IEA:Ensembl | P | positive regulation of heterotypic cell-cell adhesion |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Cofactor | Note=Iron. ; |
Similarity | Belongs to the lipoxygenase family. |
Similarity | Contains lipoxygenase domain. |
Similarity | Contains PLAT domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000437 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
134948633 | RefSeq | NP_033790 | 663 | arachidonate 15-lipoxygenase |
Identical Sequences to LMP000437 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:134948633 | DBBJ | BAE25045.1 | 663 | unnamed protein product [Mus musculus] |
GI:134948633 | GenBank | AAA20658.1 | 663 | leukocyte-type 12-lipoxygenase [Mus musculus] |
GI:134948633 | GenBank | EDL12554.1 | 663 | arachidonate 15-lipoxygenase [Mus musculus] |
GI:134948633 | GenBank | ABV02575.1 | 663 | arachidonate 15-lipoxygenase [Mus musculus] |
GI:134948633 | SwissProt | P39654.4 | 663 | RecName: Full=Arachidonate 15-lipoxygenase; Short=15-LOX; AltName: Full=12/15-lipoxygenase; Short=12/15-LO; AltName: Full=Arachidonate 12-lipoxygenase, leukocyte-type; Short=12-LOX; Short=L-12LO; AltName: Full=Arachidonate omega-6 lipoxygenase [Mus musculus] |
Related Sequences to LMP000437 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:134948633 | EMBL | CAJ18471.1 | 663 | Alox15 [Mus musculus] |
GI:134948633 | GenBank | AAA64930.1 | 663 | 12-lipoxygenase [Mus musculus] |
GI:134948633 | GenBank | AAH56625.1 | 663 | Alox15 protein [Mus musculus] |
GI:134948633 | GenBank | AAH81546.1 | 663 | Alox15 protein [Mus musculus] |
GI:134948633 | RefSeq | XP_006532099.1 | 693 | PREDICTED: arachidonate 15-lipoxygenase isoform X1 [Mus musculus] |
GI:134948633 | RefSeq | XP_006537177.1 | 693 | PREDICTED: arachidonate 15-lipoxygenase isoform X1 [Mus musculus] |