Gene/Proteome Database (LMPD)

LMPD ID
LMP000454
Gene ID
1577
Species
Homo sapiens (Human)
Gene Name
cytochrome P450, family 3, subfamily A, polypeptide 5
Gene Symbol
CYP3A5
Synonyms
CP35; CYPIIIA5; P450PCN3; PCN3
Chromosome
7
Map Location
7q21.1
EC Number
1.14.14.1
Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The encoded protein metabolizes drugs as well as the steroid hormones testosterone and progesterone. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Two pseudogenes of this gene have been identified within this cluster on chromosome 7. Expression of this gene is widely variable among populations, and a single nucleotide polymorphism that affects transcript splicing has been associated with susceptibility to hypertensions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Orthologs
View orthologs and multiple alignments for CYP3A5

Proteins

cytochrome P450 3A5 isoform 1
Refseq ID NP_000768
Protein GI 4503231
UniProt ID P20815
mRNA ID NM_000777
Length 502
RefSeq Status REVIEWED
MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDGTLSGE
cytochrome P450 3A5 isoform 2
Refseq ID NP_001177413
Protein GI 306518609
UniProt ID P20815
mRNA ID NM_001190484
Length 140
RefSeq Status REVIEWED
MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRICATTSTIKMQTHSVTMWLPPAVLQSQHGVCLFL
cytochrome P450 3A5 isoform 4 precursor
Refseq ID NP_001278759
Protein GI 628601849
UniProt ID B7Z3P6
mRNA ID NM_001291830
Length 389
RefSeq Status REVIEWED
MKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDGTLSGE
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2268 peptide sequence: MQLLMLELLLLFIVYGTRT

Gene Information

Entrez Gene ID
1577
Gene Name
cytochrome P450, family 3, subfamily A, polypeptide 5
Gene Symbol
CYP3A5
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0043231 TAS:ProtInc C intracellular membrane-bounded organelle
GO:0070330 IEA:UniProtKB-EC F aromatase activity
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004497 ISS:UniProtKB F monooxygenase activity
GO:0016491 IDA:BHF-UCL F oxidoreductase activity
GO:0019825 TAS:ProtInc F oxygen binding
GO:0009822 IDA:BHF-UCL P alkaloid catabolic process
GO:0042737 IDA:BHF-UCL P drug catabolic process
GO:0070989 IDA:BHF-UCL P oxidative demethylation
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0008202 TAS:ProtInc P steroid metabolic process
GO:0006805 TAS:Reactome P xenobiotic metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa05204 Chemical carcinogenesis
hsa00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR008072 Cytochrome P450, E-class, CYP3A
IPR002402 Cytochrome P450, E-class, group II
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 3, subfamily A, polypeptide 5
Protein Entry
CP3A5_HUMAN
UniProt ID
P20815
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P20815-1; Sequence=Displayed; Name=2; IsoId=P20815-2; Sequence=VSP_042734, VSP_042735; Note=No experimental confirmation available.;
Catalytic Activity RH + reduced flavoprotein + O(2) = ROH + oxidized flavoprotein + H(2)O.
Cofactor Name=heme; Xref=ChEBI
Function Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Induction P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.
Miscellaneous Chimeric transcripts, characterized by CYP3A43 exon 1 joined at canonical splice sites to distinct sets of CYP3A5 exons, have been detected. All are possibly produced by trans- splicing. The chimeric transcripts exist in 2 different combinations: CYP3A43 exon 1 joined in frame to CYP3A5 exon 11-13 and CYP3A43 exon 1 joined in frame to CYP3A5 exon 12-13. All chimeric transcripts are expressed at very low levels in the liver (PubMed:11726664).
Similarity Belongs to the cytochrome P450 family.
Subcellular Location Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Web Resource Name=Cytochrome P450 Allele Nomenclature Committee; Note=CYP3A5 alleles; URL="http://www.cypalleles.ki.se/cyp3a5.htm";

Identical and Related Proteins

Unique RefSeq proteins for LMP000454 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4503231 RefSeq NP_000768 502 cytochrome P450 3A5 isoform 1
306518609 RefSeq NP_001177413 140 cytochrome P450 3A5 isoform 2
628601849 RefSeq NP_001278759 389 cytochrome P450 3A5 isoform 4 precursor

Identical Sequences to LMP000454 proteins

Reference Database Accession Length Protein Name
GI:306518609 DBBJ BAH12923.1 140 unnamed protein product [Homo sapiens]
GI:4503231 EMBL CAO94944.1 502 unnamed protein product [Homo sapiens]
GI:306518609 GenBank EAW76642.1 140 cytochrome P450, family 3, subfamily A, polypeptide 5, isoform CRA_e [Homo sapiens]
GI:4503231 GenBank ABW03289.1 502 cytochrome P450, family 3, subfamily A, polypeptide 5, partial [synthetic construct]
GI:4503231 GenBank ACM80494.1 502 Sequence 5992 from patent US 6812339
GI:4503231 GenBank AFD45172.1 502 Sequence 165 from patent US 8129114
GI:4503231 GenBank AHD78002.1 502 Sequence 24981 from patent US 8586006
GI:4503231 GenBank AIC48609.1 502 CYP3A5, partial [synthetic construct]

Related Sequences to LMP000454 proteins

Reference Database Accession Length Protein Name
GI:4503231 DBBJ BAD96728.1 502 cytochrome P450, family 3, subfamily A, polypeptide 5 variant, partial [Homo sapiens]
GI:4503231 DBBJ BAG36549.1 502 unnamed protein product [Homo sapiens]
GI:306518609 GenBank AAH33862.1 502 Cytochrome P450, family 3, subfamily A, polypeptide 5 [Homo sapiens]
GI:306518609 GenBank EAL23868.1 502 cytochrome P450, family 3, subfamily A, polypeptide 5 [Homo sapiens]
GI:4503231 GenBank AAX29934.1 503 cytochrome P450 family 3 subfamily A polypeptide 5, partial [synthetic construct]
GI:4503231 GenBank AAX42491.1 502 cytochrome P450 family 3 subfamily A polypeptide 5 [synthetic construct]
GI:306518609 GenBank EAW76638.1 502 cytochrome P450, family 3, subfamily A, polypeptide 5, isoform CRA_a [Homo sapiens]
GI:4503231 GenBank ABP68412.1 502 cytochrome P450 3A5 [Pan troglodytes]
GI:4503231 GenBank ACM81593.1 507 Sequence 7091 from patent US 6812339
GI:306518609 RefSeq XP_008966988.1 140 PREDICTED: cytochrome P450 3A5 isoform X3 [Pan paniscus]
GI:306518609 RefSeq XP_009240867.1 140 PREDICTED: cytochrome P450 3A5 isoform X4 [Pongo abelii]
GI:306518609 RefSeq XP_009451525.1 140 PREDICTED: cytochrome P450, family 3, subfamily A, polypeptide 5 isoform X1 [Pan troglodytes]