Gene/Proteome Database (LMPD)

LMPD ID
LMP000457
Gene ID
Species
Mus musculus (Mouse)
Gene Name
methylsterol monoxygenase 1
Gene Symbol
Synonyms
1500001G16Rik; C78600; DESP4; ERG25; Sc4mol
Alternate Names
methylsterol monooxygenase 1; C-4 methylsterol oxidase; sterol-C4-methyl oxidase-like
Chromosome
8
Map Location
8 B3.1|8
EC Number
1.14.13.72

Proteins

methylsterol monooxygenase 1
Refseq ID NP_079712
Protein GI 13384836
UniProt ID Q9CRA4
mRNA ID NM_025436
Length 293
RefSeq Status PROVISIONAL
MATNKSVGVFSSASLAVEYVDSLLPENPLQEPFKNAWVYMLDNYTKFQIATWGSLIVHEAIYFLFSLPGFLFQFIPYMRKYKIQKDKPETFEGQWKCLKKILFNHFFIQLPLICGTYYFTEFFNIPYDWERMPRWYLTLARCLGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGIEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLVPFYTGARHHDFHHMNFIGNYASTFTWWDKLFGTDAQYHAYIEKSKKLGKKSD

Gene Information

Entrez Gene ID
Gene Name
methylsterol monoxygenase 1
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0000254 IEA:UniProtKB-EC F C-4 methylsterol oxidase activity
GO:0005506 IEA:InterPro F iron ion binding
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0016126 IEA:UniProtKB-KW P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5893434 Cholesterol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
methylsterol monoxygenase 1
Protein Entry
MSMO1_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-carbaldehyde + NAD(P)H + O(2) = 3-beta-hydroxy-4- beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)(+) + H(2)O.
Catalytic Activity 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)(+) + H(2)O.
Catalytic Activity 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 3-beta-hydroxy-4-beta- methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)(+) + 2 H(2)O.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000305};
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding.
Pathway Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 3/6.
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000457 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13384836 RefSeq NP_079712 293 methylsterol monooxygenase 1

Identical Sequences to LMP000457 proteins

Reference Database Accession Length Protein Name
GI:13384836 DBBJ BAE40814.1 293 unnamed protein product [Mus musculus]
GI:13384836 DBBJ BAE27358.1 293 unnamed protein product [Mus musculus]
GI:13384836 DBBJ BAE30143.1 293 unnamed protein product [Mus musculus]
GI:13384836 EMBL CAR81351.1 293 unnamed protein product [Mus musculus]
GI:13384836 EMBL CBX84827.1 293 unnamed protein product [Mus musculus]
GI:13384836 GenBank EDL28674.1 293 sterol-C4-methyl oxidase-like, isoform CRA_a [Mus musculus]

Related Sequences to LMP000457 proteins

Reference Database Accession Length Protein Name
GI:13384836 EMBL CAR81352.1 293 unnamed protein product [Rattus norvegicus]
GI:13384836 EMBL CBX84828.1 293 unnamed protein product [Rattus norvegicus]
GI:13384836 GenBank AAH63155.1 293 Sterol-C4-methyl oxidase-like [Rattus norvegicus]
GI:13384836 GenBank EDL75983.1 293 sterol-C4-methyl oxidase-like, isoform CRA_a [Rattus norvegicus]
GI:13384836 RefSeq NP_543162.1 293 methylsterol monooxygenase 1 [Rattus norvegicus]
GI:13384836 SwissProt O35532.1 293 RecName: Full=Methylsterol monooxygenase 1; AltName: Full=C-4 methylsterol oxidase; AltName: Full=Neuropep 1; AltName: Full=RANP-1 [Rattus norvegicus]