Gene/Proteome Database (LMPD)
LMPD ID
LMP000464
Gene ID
Species
Homo sapiens (Human)
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
Synonyms
GD3S; SIAT8; SIAT8-A; SIAT8A; ST8SiaI
Alternate Names
alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; ganglioside GD3 synthase; ganglioside GT3 synthase; sialytransferase St8Sia I; sialyltransferase St8Sia I; alpha-2,8-sialyltransferase 8A; disialoganglioside (GD3) synthase; ganglioside-specific alpha-2,8-polysialyltransferase; sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3 synthase) A; sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase, GD3 synthase)
Chromosome
12
Map Location
12p12.1-p11.2
EC Number
2.4.99.8
Summary
Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| alpha-N-acetylneuraminide alpha-2,8-sialyltransferase | |
|---|---|
| Refseq ID | NP_003025 |
| Protein GI | 4506953 |
| UniProt ID | Q92185 |
| mRNA ID | NM_003034 |
| Length | 356 |
| RefSeq Status | REVIEWED |
| MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS | |
Gene Information
Entrez Gene ID
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0016021 | TAS:ProtInc | C | integral component of membrane |
| GO:0003828 | IEA:UniProtKB-EC | F | alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity |
| GO:0008373 | TAS:ProtInc | F | sialyltransferase activity |
| GO:0005975 | TAS:ProtInc | P | carbohydrate metabolic process |
| GO:0034605 | IEA:Ensembl | P | cellular response to heat |
| GO:0006688 | TAS:ProtInc | P | glycosphingolipid biosynthetic process |
| GO:0008284 | IEA:Ensembl | P | positive regulation of cell proliferation |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
| GO:0097503 | TAS:GOC | P | sialylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00603 | Glycosphingolipid biosynthesis - globo series |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_200874 | Sialic acid metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Protein Entry
SIA8A_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q92185-1; Sequence=Displayed; Name=2; Synonyms=Sat-2; IsoId=Q92185-2; Sequence=VSP_047583, VSP_047584; |
| Catalytic Activity | CMP-N-acetylneuraminate + alpha-N- acetylneuraminyl-(2->3)-beta-D-galactosyl-R = CMP + alpha-N- acetylneuraminyl-(2->8)-alpha-N-acetylneuraminyl-(2->3)-beta-D- galactosyl-R. {ECO |
| Function | Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid. {ECO |
| Pathway | Lipid metabolism; sphingolipid metabolism. |
| Pathway | Protein modification; protein glycosylation. |
| Sequence Caution | Sequence=AAC37586.1; Type=Erroneous initiation; Evidence= ; Sequence=CAA54891.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the glycosyltransferase 29 family. |
| Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
| Tissue Specificity | Strongly expressed in melanoma cell lines, adult and fetal brain and to a lesser extent in adult and fetal lung. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=ST8Sia I; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_636"; |
| Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST8SIA1"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000464 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4506953 | RefSeq | NP_003025 | 356 | alpha-N-acetylneuraminide alpha-2,8-sialyltransferase |
Identical Sequences to LMP000464 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4506953 | GenBank | ACM80809.1 | 356 | Sequence 6307 from patent US 6812339 |
| GI:4506953 | GenBank | ADR82955.1 | 356 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1, partial [synthetic construct] |
| GI:4506953 | GenBank | AFG79824.1 | 356 | Sequence 83 from patent US 8137928 |
| GI:4506953 | GenBank | AIC49727.1 | 356 | ST8SIA1, partial [synthetic construct] |
| GI:4506953 | RefSeq | XP_003828937.1 | 356 | PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Pan paniscus] |
| GI:4506953 | RefSeq | XP_004052910.1 | 356 | PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Gorilla gorilla gorilla] |
Related Sequences to LMP000464 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4506953 | GenBank | AAQ53140.1 | 356 | Sequence 2 from patent US 6596523 |
| GI:4506953 | GenBank | ABN29101.1 | 356 | Sequence 2 from patent US 7163791 |
| GI:4506953 | GenBank | ACM82503.1 | 368 | Sequence 8001 from patent US 6812339 |
| GI:4506953 | GenBank | EHH20580.1 | 356 | Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Macaca mulatta] |
| GI:4506953 | RefSeq | XP_003906151.1 | 356 | PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Papio anubis] |
| GI:4506953 | RefSeq | XP_005570409.1 | 356 | PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase isoform X1 [Macaca fascicularis] |