Gene/Proteome Database (LMPD)

LMPD ID
LMP000464
Gene ID
6489
Species
Homo sapiens (Human)
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
ST8SIA1
Synonyms
GD3S; SIAT8; SIAT8-A; SIAT8A; ST8SiaI
Alternate Names
alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; ganglioside GD3 synthase; ganglioside GT3 synthase; sialytransferase St8Sia I; sialyltransferase St8Sia I; alpha-2,8-sialyltransferase 8A; disialoganglioside (GD3) synthase; ganglioside-specific alpha-2,8-polysialyltransferase; sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3 synthase) A; sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase, GD3 synthase)
Chromosome
12
Map Location
12p12.1-p11.2
EC Number
2.4.99.8
Summary
Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for ST8SIA1

Proteins

alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
Refseq ID NP_003025
Protein GI 4506953
UniProt ID Q92185
mRNA ID NM_003034
Length 356
RefSeq Status REVIEWED
MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS

Gene Information

Entrez Gene ID
6489
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
ST8SIA1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0016021 TAS:ProtInc C integral component of membrane
GO:0003828 IEA:UniProtKB-EC F alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity
GO:0008373 TAS:ProtInc F sialyltransferase activity
GO:0005975 TAS:ProtInc P carbohydrate metabolic process
GO:0034605 IEA:Ensembl P cellular response to heat
GO:0006688 TAS:ProtInc P glycosphingolipid biosynthetic process
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation
GO:0097503 TAS:GOC P sialylation

KEGG Pathway Links

KEGG Pathway ID Description
hsa00603 Glycosphingolipid biosynthesis - globo series

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_200874 Sialic acid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Protein Entry
SIA8A_HUMAN
UniProt ID
Q92185
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q92185-1; Sequence=Displayed; Name=2; Synonyms=Sat-2; IsoId=Q92185-2; Sequence=VSP_047583, VSP_047584;
Catalytic Activity CMP-N-acetylneuraminate + alpha-N- acetylneuraminyl-(2->3)-beta-D-galactosyl-R = CMP + alpha-N- acetylneuraminyl-(2->8)-alpha-N-acetylneuraminyl-(2->3)-beta-D- galactosyl-R. {ECO
Function Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid. {ECO
Pathway Lipid metabolism; sphingolipid metabolism.
Pathway Protein modification; protein glycosylation.
Sequence Caution Sequence=AAC37586.1; Type=Erroneous initiation; Evidence= ; Sequence=CAA54891.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the glycosyltransferase 29 family.
Subcellular Location Golgi apparatus membrane ; Single-pass type II membrane protein .
Tissue Specificity Strongly expressed in melanoma cell lines, adult and fetal brain and to a lesser extent in adult and fetal lung.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=ST8Sia I; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_636";
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST8SIA1";

Identical and Related Proteins

Unique RefSeq proteins for LMP000464 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4506953 RefSeq NP_003025 356 alpha-N-acetylneuraminide alpha-2,8-sialyltransferase

Identical Sequences to LMP000464 proteins

Reference Database Accession Length Protein Name
GI:4506953 GenBank ACM80809.1 356 Sequence 6307 from patent US 6812339
GI:4506953 GenBank ADR82955.1 356 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1, partial [synthetic construct]
GI:4506953 GenBank AFG79824.1 356 Sequence 83 from patent US 8137928
GI:4506953 GenBank AIC49727.1 356 ST8SIA1, partial [synthetic construct]
GI:4506953 RefSeq XP_003828937.1 356 PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Pan paniscus]
GI:4506953 RefSeq XP_004052910.1 356 PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Gorilla gorilla gorilla]

Related Sequences to LMP000464 proteins

Reference Database Accession Length Protein Name
GI:4506953 GenBank AAQ53140.1 356 Sequence 2 from patent US 6596523
GI:4506953 GenBank ABN29101.1 356 Sequence 2 from patent US 7163791
GI:4506953 GenBank ACM82503.1 368 Sequence 8001 from patent US 6812339
GI:4506953 GenBank EHH20580.1 356 Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Macaca mulatta]
GI:4506953 RefSeq XP_003906151.1 356 PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Papio anubis]
GI:4506953 RefSeq XP_005570409.1 356 PREDICTED: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase isoform X1 [Macaca fascicularis]