Gene/Proteome Database (LMPD)
LMPD ID
LMP000484
Gene ID
Species
Homo sapiens (Human)
Gene Name
phospholipase A2, group XV
Gene Symbol
Synonyms
ACS; GXVPLA2; LLPL; LPLA2; LYPLA3
Alternate Names
group XV phospholipase A2; 1-O-acylceramide synthase; lysosomal phospholipase A2; LCAT-like lysophospholipase; lysophospholipase 3 (lysosomal phospholipase A2)
Chromosome
16
Map Location
16q22.1
EC Number
2.3.1.-
Summary
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is present in the plasma and thought to be associated with high-density lipoprotein. A later paper contradicts the function of this gene. It demonstrates that this gene encodes a lysosomal enzyme instead of a lysophospholipase and has both calcium-independent phospholipase A2 and transacylase activities. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| group XV phospholipase A2 precursor | |
|---|---|
| Refseq ID | NP_036452 |
| Protein GI | 6912484 |
| UniProt ID | Q8NCC3 |
| mRNA ID | NM_012320 |
| Length | 412 |
| RefSeq Status | REVIEWED |
| MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP | |
| sig_peptide: 1..33 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3656 peptide sequence: MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALP | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0005764 | ISS:UniProtKB | C | lysosome |
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0008374 | ISS:UniProtKB | F | O-acyltransferase activity |
| GO:0047499 | ISS:UniProtKB | F | calcium-independent phospholipase A2 activity |
| GO:0004622 | TAS:ProtInc | F | lysophospholipase activity |
| GO:0005543 | TAS:ProtInc | F | phospholipid binding |
| GO:0006672 | IEA:Ensembl | P | ceramide metabolic process |
| GO:0009062 | TAS:ProtInc | P | fatty acid catabolic process |
| GO:0046470 | IEA:Ensembl | P | phosphatidylcholine metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8NCC3-1; Sequence=Displayed; Name=2; IsoId=Q8NCC3-2; Sequence=VSP_056689, VSP_056690; Note=No experimental confirmation available.; |
| Function | Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N- acetylsphingosine and the concomitant release of a lyso- phospholipid (By similarity). May have weak lysophospholipase activity. |
| Ptm | N-glycosylated. |
| Sequence Caution | Sequence=CAB53675.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the AB hydrolase superfamily. Lipase family. |
| Subcellular Location | Lysosome . Secreted . |
| Tissue Specificity | Highly expressed in heart, placenta, skeletal muscle, kidney and pancreas. Detected at lower levels in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000484 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6912484 | RefSeq | NP_036452 | 412 | group XV phospholipase A2 precursor |
Identical Sequences to LMP000484 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6912484 | GenBank | ACW43773.1 | 412 | Sequence 11 from patent US 7582442 |
| GI:6912484 | GenBank | ACW64602.1 | 412 | Sequence 14 from patent US 7589172 |
| GI:6912484 | GenBank | ADM02107.1 | 412 | Sequence 157 from patent US 7723488 |
| GI:6912484 | GenBank | ADS45517.1 | 412 | Sequence 14 from patent US 7795412 |
| GI:6912484 | GenBank | AEU43252.1 | 412 | Sequence 1 from patent US 8052970 |
| GI:6912484 | GenBank | AEU43362.1 | 412 | Sequence 111 from patent US 8052970 |
Related Sequences to LMP000484 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6912484 | DBBJ | BAC11233.1 | 412 | unnamed protein product [Homo sapiens] |
| GI:6912484 | DBBJ | BAD96510.1 | 412 | lysophospholipase 3 (lysosomal phospholipase A2) variant, partial [Homo sapiens] |
| GI:6912484 | EMBL | CAF86006.1 | 412 | unnamed protein product [Homo sapiens] |
| GI:6912484 | EMBL | CAH91230.1 | 412 | hypothetical protein [Pongo abelii] |
| GI:6912484 | RefSeq | NP_001125726.1 | 412 | group XV phospholipase A2 precursor [Pongo abelii] |
| GI:6912484 | RefSeq | XP_004057908.1 | 412 | PREDICTED: group XV phospholipase A2 [Gorilla gorilla gorilla] |