Gene/Proteome Database (LMPD)

LMPD ID
LMP000493
Gene ID
55937
Species
Homo sapiens (Human)
Gene Name
apolipoprotein M
Gene Symbol
APOM
Synonyms
G3a; HSPC336; NG20; apo-M
Alternate Names
apolipoprotein M; protein G3a; NG20-like protein; alternative name: G3a, NG20
Chromosome
6
Map Location
6p21.33
Summary
The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. [provided by RefSeq, Jan 2012]
Orthologs
View orthologs and multiple alignments for APOM

Proteins

apolipoprotein M isoform 1
Refseq ID NP_061974
Protein GI 22091452
UniProt ID O95445
mRNA ID NM_019101
Length 188
RefSeq Status REVIEWED
MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
apolipoprotein M isoform 2
Refseq ID NP_001243098
Protein GI 371873523
UniProt ID O95445
mRNA ID NM_001256169
Length 116
RefSeq Status REVIEWED
MAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Gene Information

Entrez Gene ID
55937
Gene Name
apolipoprotein M
Gene Symbol
APOM
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0034365 IDA:BHF-UCL C discoidal high-density lipoprotein particle
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0034364 IDA:BHF-UCL C high-density lipoprotein particle
GO:0005887 TAS:ProtInc C integral component of plasma membrane
GO:0034362 IDA:BHF-UCL C low-density lipoprotein particle
GO:0034366 IDA:BHF-UCL C spherical high-density lipoprotein particle
GO:0034361 IDA:BHF-UCL C very-low-density lipoprotein particle
GO:0016209 IDA:BHF-UCL F antioxidant activity
GO:0005319 IDA:BHF-UCL F lipid transporter activity
GO:0005543 IDA:BHF-UCL F phospholipid binding
GO:0033344 IDA:BHF-UCL P cholesterol efflux
GO:0042632 IC:BHF-UCL P cholesterol homeostasis
GO:0034380 ISS:BHF-UCL P high-density lipoprotein particle assembly
GO:0034384 ISS:BHF-UCL P high-density lipoprotein particle clearance
GO:0034375 IMP:BHF-UCL P high-density lipoprotein particle remodeling
GO:0042157 IEA:Ensembl P lipoprotein metabolic process
GO:0034445 IDA:BHF-UCL P negative regulation of plasma lipoprotein particle oxidation
GO:0009749 IEA:Ensembl P response to glucose
GO:0043691 ISS:BHF-UCL P reverse cholesterol transport

Domain Information

InterPro Annotations

Accession Description
IPR022734 Apolipoprotein M
IPR011038 Calycin-like

UniProt Annotations

Entry Information

Gene Name
apolipoprotein M
Protein Entry
APOM_HUMAN
UniProt ID
O95445
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O95445-1; Sequence=Displayed; Name=2; IsoId=O95445-2; Sequence=VSP_045586; Note=No experimental confirmation available.;
Function Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid.
Similarity Belongs to the calycin superfamily. Lipocalin family. Highly divergent.
Subcellular Location Secreted {ECO
Tissue Specificity Plasma protein. Expressed in liver and kidney.

Identical and Related Proteins

Unique RefSeq proteins for LMP000493 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22091452 RefSeq NP_061974 188 apolipoprotein M isoform 1
371873523 RefSeq NP_001243098 116 apolipoprotein M isoform 2

Identical Sequences to LMP000493 proteins

Reference Database Accession Length Protein Name
GI:371873523 GenBank EAX03461.1 116 apolipoprotein M, isoform CRA_a [Homo sapiens]
GI:22091452 GenBank ADS58915.1 188 Sequence 66 from patent US 7807392
GI:371873523 GenBank ADS58917.1 116 Sequence 68 from patent US 7807392
GI:22091452 GenBank ADT44550.1 188 Sequence 219 from patent US 7838636
GI:22091452 GenBank AEK13841.1 188 Sequence 10 from patent US 7972802
GI:22091452 GenBank AGM56994.1 188 Sequence 10 from patent US 8420337
GI:22091452 GenBank AHE01113.1 188 Sequence 56029 from patent US 8586006
GI:22091452 GenBank AIC51871.1 188 APOM, partial [synthetic construct]
GI:371873523 RefSeq XP_004087137.1 116 PREDICTED: apolipoprotein M isoform 2 [Nomascus leucogenys]

Related Sequences to LMP000493 proteins

Reference Database Accession Length Protein Name
GI:371873523 DBBJ BAB63389.1 188 Apolipoprotein M [Homo sapiens]
GI:22091452 EMBL CAH92016.1 188 hypothetical protein [Pongo abelii]
GI:371873523 GenBank AAD18084.1 188 Apo M [Homo sapiens]
GI:371873523 GenBank AAF29014.1 186 HSPC336, partial [Homo sapiens]
GI:371873523 GenBank AAE50166.1 188 Sequence 2 from patent US 6114123
GI:371873523 GenBank AAR64406.1 188 Sequence 217 from patent US 6627741
GI:371873523 GenBank AHE01113.1 188 Sequence 56029 from patent US 8586006
GI:22091452 RefSeq XP_518354.2 188 PREDICTED: apolipoprotein M isoform X1 [Pan troglodytes]
GI:22091452 RefSeq NP_001126170.1 188 apolipoprotein M precursor [Pongo abelii]
GI:22091452 RefSeq XP_003831630.1 188 PREDICTED: apolipoprotein M isoform X1 [Pan paniscus]
GI:22091452 RefSeq XP_004043716.1 188 PREDICTED: apolipoprotein M isoform 1 [Gorilla gorilla gorilla]
GI:22091452 SwissProt Q5R894.1 188 RecName: Full=Apolipoprotein M; Short=Apo-M; Short=ApoM [Pongo abelii]