Gene/Proteome Database (LMPD)
LMPD ID
LMP000504
Gene ID
Species
Homo sapiens (Human)
Gene Name
arachidonate 15-lipoxygenase
Gene Symbol
Synonyms
12-LOX; 15-LOX-1; 15LOX-1
Alternate Names
arachidonate 15-lipoxygenase; 15-LOX; 12/15-lipoxygenase; 15-lipooxygenase-1; arachidonate omega-6 lipoxygenase; arachidonate 12-lipoxygenase, leukocyte-type
Chromosome
17
Map Location
17p13.3
EC Number
1.13.11.33
Proteins
| arachidonate 15-lipoxygenase | |
|---|---|
| Refseq ID | NP_001131 |
| Protein GI | 40316937 |
| UniProt ID | P16050 |
| mRNA ID | NM_001140 |
| Length | 662 |
| RefSeq Status | VALIDATED |
| MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IDA:UniProtKB | C | cytosol |
| GO:0031234 | IDA:UniProtKB | C | extrinsic component of cytoplasmic side of plasma membrane |
| GO:0005811 | IDA:UniProtKB | C | lipid particle |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0005886 | ISS:UniProtKB | C | plasma membrane |
| GO:0004052 | IDA:UniProtKB | F | arachidonate 12-lipoxygenase activity |
| GO:0050473 | IDA:UniProtKB | F | arachidonate 15-lipoxygenase activity |
| GO:0097260 | TAS:Reactome | F | eoxin A4 synthase activity |
| GO:0005506 | ISS:UniProtKB | F | iron ion binding |
| GO:0005546 | IDA:UniProtKB | F | phosphatidylinositol-4,5-bisphosphate binding |
| GO:0043277 | ISS:UniProtKB | P | apoptotic cell clearance |
| GO:0019369 | IDA:UniProtKB | P | arachidonic acid metabolic process |
| GO:0030282 | ISS:UniProtKB | P | bone mineralization |
| GO:0071277 | IDA:UniProtKB | P | cellular response to calcium ion |
| GO:0035963 | IMP:UniProtKB | P | cellular response to interleukin-13 |
| GO:0051122 | ISS:UniProtKB | P | hepoxilin biosynthetic process |
| GO:0006954 | TAS:ProtInc | P | inflammatory response |
| GO:0006691 | TAS:Reactome | P | leukotriene metabolic process |
| GO:2001303 | ISS:UniProtKB | P | lipoxin A4 biosynthetic process |
| GO:0019372 | IDA:UniProtKB | P | lipoxygenase pathway |
| GO:0002820 | ISS:UniProtKB | P | negative regulation of adaptive immune response |
| GO:0001503 | ISS:UniProtKB | P | ossification |
| GO:0006646 | ISS:UniProtKB | P | phosphatidylethanolamine biosynthetic process |
| GO:0070374 | IMP:UniProtKB | P | positive regulation of ERK1 and ERK2 cascade |
| GO:0030838 | ISS:UniProtKB | P | positive regulation of actin filament polymerization |
| GO:0010811 | IDA:UniProtKB | P | positive regulation of cell-substrate adhesion |
| GO:1901074 | ISS:UniProtKB | P | regulation of engulfment of apoptotic cell |
| GO:0035358 | ISS:UniProtKB | P | regulation of peroxisome proliferator activated receptor signaling pathway |
| GO:0034976 | ISS:UniProtKB | P | response to endoplasmic reticulum stress |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0042060 | ISS:UniProtKB | P | wound healing |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04726 | Serotonergic synapse |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150201 | Synthesis of 12-eicosatetraenoic acid derivatives |
| REACT_150422 | Synthesis of 15-eicosatetraenoic acid derivatives |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P16050-1; Sequence=Displayed; Name=2; IsoId=P16050-2; Sequence=VSP_056681; Note=No experimental confirmation available.; |
| Catalytic Activity | Arachidonate + O(2) = (5Z,8Z,10E,14Z)-(12S)- 12-hydroperoxyicosa-5,8,10,14-tetraenoate. |
| Catalytic Activity | Arachidonate + O(2) = (5Z,8Z,11Z,13E)-(15S)- 15-hydroperoxyicosa-5,8,11,13-tetraenoate. |
| Cofactor | Name=Fe cation; Xref=ChEBI |
| Disease | Note=Disease susceptibility may be associated with variations affecting the gene represented in this entry. Met at position 560 may confer interindividual susceptibility to coronary artery disease (CAD) (PubMed:17959182). |
| Domain | The PLAT domain can bind calcium ions; this promotes association with membranes. |
| Enzyme Regulation | Activity is increased by binding phosphatidylinositol phosphates, especially phosphatidylinositol 3,4-bisphosphate and phosphatidylinositol 4,5-bisphosphate. |
| Function | Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Converts arachidonic acid into 12- hydroperoxyeicosatetraenoic acid/12-HPETE and 15- hydroperoxyeicosatetraenoic acid/15-HPETE. Also converts linoleic acid to 13-hydroperoxyoctadecadienoic acid. May also act on (12S)- hydroperoxyeicosatetraenoic acid/(12S)-HPETE to produce hepoxilin A3. Probably plays an important role in the immune and inflammatory responses. Through the oxygenation of membrane-bound phosphatidylethanolamine in macrophages may favor clearance of apoptotic cells during inflammation by resident macrophages and prevent an autoimmune response associated with the clearance of apoptotic cells by inflammatory monocytes. In parallel, may regulate actin polymerization which is crucial for several biological processes, including macrophage function. May also regulate macrophage function through regulation of the peroxisome proliferator activated receptor signaling pathway. Finally, it is also involved in the cellular response to IL13/interleukin-13. In addition to its role in the immune and inflammatory responses, may play a role in epithelial wound healing in the cornea maybe through production of lipoxin A4. May also play a role in endoplasmic reticulum stress response and the regulation of bone mass. |
| Induction | Up-regulated by UV-irradiation. |
| Pathway | Lipid metabolism; hydroperoxy eicosatetraenoic acid biosynthesis. |
| Similarity | Belongs to the lipoxygenase family. |
| Similarity | Contains 1 PLAT domain. {ECO |
| Similarity | Contains 1 lipoxygenase domain. {ECO |
| Subcellular Location | Cytoplasm, cytosol. Cell membrane; Peripheral membrane protein. Lipid droplet. Note=Predominantly cytosolic; becomes enriched at membranes upon calcium binding. Translocates from the cytosol to the plasma membrane when stimulated by IL13/interleukin-13 and in macrophages binding apoptotic cells. |
| Subunit | Interacts with PEBP1; in response to IL13/interleukin-13, prevents the interaction of PEBP1 with RAF1 to activate the ERK signaling cascade. |
| Tissue Specificity | Detected in monocytes and eosinophils (at protein level). Expressed in airway epithelial cells. |
| Web Resource | Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/ALOX15ID42986ch17p13.html"; |
| Web Resource | Name=SeattleSNPs; URL="http://pga.gs.washington.edu/data/alox15/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000504 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 40316937 | RefSeq | NP_001131 | 662 | arachidonate 15-lipoxygenase |
Identical Sequences to LMP000504 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:40316937 | DBBJ | BAF82998.1 | 662 | unnamed protein product [Homo sapiens] |
| GI:40316937 | DBBJ | BAJ20998.1 | 662 | arachidonate 15-lipoxygenase, partial [synthetic construct] |
| GI:40316937 | GenBank | AAR77023.1 | 662 | Sequence 25 from patent US 6649355 |
| GI:40316937 | GenBank | AAR84235.1 | 662 | arachidonate 15-lipoxygenase [Homo sapiens] |
| GI:40316937 | GenBank | AAY75412.1 | 662 | Sequence 315 from patent US 6900016 |
| GI:40316937 | GenBank | AHE03456.1 | 662 | Sequence 65264 from patent US 8586006 |
Related Sequences to LMP000504 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:40316937 | DBBJ | BAG35454.1 | 662 | unnamed protein product [Homo sapiens] |
| GI:40316937 | DBBJ | BAH12437.1 | 684 | unnamed protein product [Homo sapiens] |
| GI:40316937 | GenBank | AAH29032.1 | 662 | Arachidonate 15-lipoxygenase [Homo sapiens] |
| GI:40316937 | GenBank | AIC53988.1 | 662 | ALOX15, partial [synthetic construct] |
| GI:40316937 | RefSeq | XP_003315361.1 | 684 | PREDICTED: arachidonate 15-lipoxygenase [Pan troglodytes] |
| GI:40316937 | RefSeq | XP_008960822.1 | 662 | PREDICTED: arachidonate 15-lipoxygenase [Pan paniscus] |