Gene/Proteome Database (LMPD)

LMPD ID
LMP000511
Gene ID
18754
Species
Mus musculus (Mouse)
Gene Name
protein kinase C, epsilon
Gene Symbol
Prkce
Synonyms
5830406C15Rik; PKC[e]; PKCepsilon; Pkce; R75156
Alternate Names
protein kinase C epsilon type; nPKC-epsilon
Chromosome
17
Map Location
17 E4|17
EC Number
2.7.11.13

Proteins

protein kinase C epsilon type
Refseq ID NP_035234
Protein GI 6755084
UniProt ID P16054
mRNA ID NM_011104
Length 737
RefSeq Status VALIDATED
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGKVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLAAGAESPQPASGNSPSEDDRSKSAPTSPCDQELKELENNIRKALSFDNRGEEHRASSATDGQLASPGENGEVRPGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGIMNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVAAQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPILTLVDEAIIKQINQEEFKGFSYFGEDLMP

Gene Information

Entrez Gene ID
18754
Gene Name
protein kinase C, epsilon
Gene Symbol
Prkce
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0071944 IDA:UniProtKB C cell periphery
GO:0005737 IDA:MGI C cytoplasm
GO:0005856 IEA:UniProtKB-KW C cytoskeleton
GO:0005829 IDA:MGI C cytosol
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016020 IDA:UniProtKB C membrane
GO:0005739 IDA:MGI C mitochondrion
GO:0005634 IDA:MGI C nucleus
GO:0048471 IDA:UniProtKB C perinuclear region of cytoplasm
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0071889 IPI:UniProtKB F 14-3-3 protein binding
GO:0003785 IDA:UniProtKB F actin monomer binding
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0004699 IDA:MGI F calcium-independent protein kinase C activity
GO:0008047 IEA:Ensembl F enzyme activator activity
GO:0035276 IDA:MGI F ethanol binding
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0004674 IDA:MGI F protein serine/threonine kinase activity
GO:0030546 IDA:MGI F receptor activator activity
GO:0007155 IEA:UniProtKB-KW P cell adhesion
GO:0007049 IEA:UniProtKB-KW P cell cycle
GO:0051301 IEA:UniProtKB-KW P cell division
GO:0071361 IGI:MGI P cellular response to ethanol
GO:0071456 IDA:MGI P cellular response to hypoxia
GO:0007635 TAS:MGI P chemosensory behavior
GO:0035556 IEA:InterPro P intracellular signal transduction
GO:0031663 IMP:UniProtKB P lipopolysaccharide-mediated signaling pathway
GO:0035641 IGI:MGI P locomotory exploration behavior
GO:0002281 IMP:MGI P macrophage activation involved in immune response
GO:0030838 IDA:UniProtKB P positive regulation of actin filament polymerization
GO:0010811 IMP:MGI P positive regulation of cell-substrate adhesion
GO:2001031 IEA:Ensembl P positive regulation of cellular glucuronidation
GO:0032467 ISS:UniProtKB P positive regulation of cytokinesis
GO:0010634 ISS:UniProtKB P positive regulation of epithelial cell migration
GO:0010763 IMP:UniProtKB P positive regulation of fibroblast migration
GO:0043123 IMP:MGI P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032024 IMP:MGI P positive regulation of insulin secretion
GO:0050996 IMP:MGI P positive regulation of lipid catabolic process
GO:0043410 IDA:MGI P positive regulation of MAPK cascade
GO:0070257 IMP:MGI P positive regulation of mucus secretion
GO:2000273 IDA:GOC P positive regulation of receptor activity
GO:0032230 IMP:MGI P positive regulation of synaptic transmission, GABAergic
GO:0090303 ISS:UniProtKB P positive regulation of wound healing
GO:0006468 IDA:MGI P protein phosphorylation
GO:0061178 IMP:MGI P regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0019216 IMP:MGI P regulation of lipid metabolic process
GO:0050730 IMP:MGI P regulation of peptidyl-tyrosine phosphorylation
GO:0051209 IMP:MGI P release of sequestered calcium ion into cytosol
GO:0043278 IMP:MGI P response to morphine
GO:0035669 IMP:UniProtKB P TRAM-dependent toll-like receptor 4 signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
mmu04022 cGMP-PKG signaling pathway
mmu04750 Inflammatory mediator regulation of TRP channels
mmu05206 MicroRNAs in cancer

Domain Information

InterPro Annotations

Accession Description
IPR000961 AGC-kinase, C-terminal
IPR000008 C2 domain
IPR020454 Diacylglycerol/phorbol-ester binding
IPR017441 Protein kinase, ATP binding site
IPR014376 Protein kinase C, delta/epsilon/eta/theta types
IPR027274 Protein kinase C, epsilon
IPR002219 Protein kinase C-like, phorbol ester/diacylglycerol-binding domain
IPR017892 Protein kinase, C-terminal
IPR000719 Protein kinase domain
IPR011009 Protein kinase-like domain
IPR002290 Serine/threonine/dual specificity protein kinase, catalytic domain
IPR008271 Serine/threonine-protein kinase, active site

UniProt Annotations

Entry Information

Gene Name
protein kinase C, epsilon
Protein Entry
KPCE_MOUSE
UniProt ID
P16054
Species
Mouse

Comments

Comment Type Description
Catalytic Activity ATP + a protein = ADP + a phosphoprotein.
Domain The C1 domain, containing the phorbol ester/DAG-type region 1 (C1A) and 2 (C1B), is the diacylglycerol sensor and the C2 domain is a non-calcium binding domain.
Enzyme Regulation Novel PKCs (PRKCD, PRKCE, PRKCH and PRKCQ) are calcium-insensitive, but activated by diacylglycerol (DAG) and phosphatidylserine. Three specific sites; Thr-566 (activation loop of the kinase domain), Thr-710 (turn motif) and Ser-729 (hydrophobic region), need to be phosphorylated for its full activation.
Function Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays essential roles in the regulation of multiple cellular processes linked to cytoskeletal proteins, such as cell adhesion, motility, migration and cell cycle, functions in neuron growth and ion channel regulation, and is involved in immune response, cancer cell invasion and regulation of apoptosis. Mediates cell adhesion to the extracellular matrix via integrin-dependent signaling, by mediating angiotensin-2-induced activation of integrin beta-1 (ITGB1) in cardiac fibroblasts. Phosphorylates MARCKS, which phosphorylates and activates PTK2/FAK, leading to the spread of cardiomyocytes. Involved in the control of the directional transport of ITGB1 in mesenchymal cells by phosphorylating vimentin (VIM), an intermediate filament (IF) protein. In epithelial cells, associates with and phosphorylates keratin-8 (KRT8), which induces targeting of desmoplakin at desmosomes and regulates cell-cell contact. Phosphorylates IQGAP1, which binds to CDC42, mediating epithelial cell-cell detachment prior to migration. During cytokinesis, forms a complex with YWHAB, which is crucial for daughter cell separation, and facilitates abscission by a mechanism which may implicate the regulation of RHOA. In cardiac myocytes, regulates myofilament function and excitation coupling at the Z-lines, where it is indirectly associated with F-actin via interaction with COPB1. During endothelin-induced cardiomyocyte hypertrophy, mediates activation of PTK2/FAK, which is critical for cardiomyocyte survival and regulation of sarcomere length. Plays a role in the pathogenesis of dilated cardiomyopathy via persistent phosphorylation of troponin I (TNNI3). Involved in nerve growth factor (NFG)-induced neurite outgrowth and neuron morphological change independently of its kinase activity, by inhibition of RHOA pathway, activation of CDC42 and cytoskeletal rearrangement. May be involved in presynaptic facilitation by mediating phorbol ester-induced synaptic potentiation. Phosphorylates gamma-aminobutyric acid receptor subunit gamma-2 (GABRG2), which reduces the response of GABA receptors to ethanol and benzodiazepines and may mediate acute tolerance to the intoxicating effects of ethanol. Upon PMA treatment, phosphorylates the capsaicin- and heat-activated cation channel TRPV1, which is required for bradykinin-induced sensitization of the heat response in nociceptive neurons. Is able to form a complex with PDLIM5 and N-type calcium channel, and may enhance channel activities and potentiates fast synaptic transmission by phosphorylating the pore-forming alpha subunit CACNA1B (CaV2.2). Downstream of TLR4, plays an important role in the lipopolysaccharide (LPS)-induced immune response by phosphorylating and activating TICAM2/TRAM, which in turn activates the transcription factor IRF3 and subsequent cytokines production. In differentiating erythroid progenitors, is regulated by EPO and controls the protection against the TNFSF10/TRAIL- mediated apoptosis, via BCL2. May be involved in the regulation of the insulin-induced phosphorylation and activation of AKT1. {ECO:0000269|PubMed:11746497, ECO:0000269|PubMed:12407104, ECO:0000269|PubMed:15949469, ECO:0000269|PubMed:16270034, ECO:0000269|PubMed:16445938, ECO:0000269|PubMed:16757566, ECO:0000269|PubMed:18604201}.
Interaction Q9CQV8:Ywhab; NbExp=6; IntAct=EBI-298451, EBI-771608;
Ptm Phosphorylation on Thr-566 by PDPK1 triggers autophosphorylation on Ser-729 (By similarity). Phosphorylation in the hinge domain at Ser-350 by MAPK11 or MAPK14, Ser-346 by GSK3B and Ser-368 by autophosphorylation is required for interaction with YWHAB. {ECO:0000250, ECO:0000269|PubMed:15345747, ECO:0000269|PubMed:17611075, ECO:0000269|PubMed:18237277, ECO:0000269|PubMed:18604201}.
Similarity Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily. {ECO:0000305}.
Similarity Contains 1 AGC-kinase C-terminal domain. {ECO:0000305}.
Similarity Contains 1 C2 domain. {ECO:0000255|PROSITE- ProRule:PRU00041}.
Similarity Contains 1 protein kinase domain. {ECO:0000255|PROSITE-ProRule:PRU00159}.
Similarity Contains 2 phorbol-ester/DAG-type zinc fingers. {ECO:0000255|PROSITE-ProRule:PRU00226}.
Subcellular Location Cytoplasm {ECO:0000250}. Cytoplasm, cytoskeleton {ECO:0000250}. Cell membrane {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:17611075}. Nucleus {ECO:0000269|PubMed:17611075}. Note=Translocated to plasma membrane in epithelial cells stimulated by HGF (By similarity). Associated with the Golgi at the perinuclear site in pre-passage fibroblasts. In passaging cells, translocated to the cell periphery. Translocated to the nucleus in PMA-treated cells. {ECO:0000250}.
Subunit Forms a ternary complex with TRIM63 and GN2BL1. Can form a complex with PDLIM5 and N-type calcium channel. Interacts with COPB1, DGKQ and STAT3 (By similarity). Interacts with YWHAB. {ECO:0000250, ECO:0000269|PubMed:11746497, ECO:0000269|PubMed:18604201}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000511 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6755084 RefSeq NP_035234 737 protein kinase C epsilon type

Identical Sequences to LMP000511 proteins

Reference Database Accession Length Protein Name
GI:6755084 GenBank AAY75307.1 737 Sequence 4 from patent US 6897352
GI:6755084 GenBank ABK42347.1 737 protein kinase C epsilon [synthetic construct]
GI:6755084 GenBank EDL38612.1 737 protein kinase C, epsilon [Mus musculus]
GI:6755084 GenBank AAI65948.1 737 Protein kinase C, epsilon [synthetic construct]
GI:6755084 GenBank AGN47661.1 737 Sequence 4 from patent US 8343939
GI:6755084 GenBank AHE12388.1 737 Sequence 2 from patent US 8598146

Related Sequences to LMP000511 proteins

Reference Database Accession Length Protein Name
GI:6755084 GenBank AAA41872.1 737 protein kinase C epsilon subspecies [Rattus sp.]
GI:6755084 GenBank AAT65503.1 737 protein kinase C epsilon [Rattus norvegicus]
GI:6755084 GenBank AHE12400.1 737 Sequence 15 from patent US 8598146
GI:6755084 RefSeq XP_003496276.1 737 PREDICTED: protein kinase C epsilon type [Cricetulus griseus]
GI:6755084 RefSeq XP_007618739.1 737 PREDICTED: protein kinase C epsilon type [Cricetulus griseus]
GI:6755084 SwissProt P09216.1 737 RecName: Full=Protein kinase C epsilon type; AltName: Full=nPKC-epsilon [Rattus norvegicus]