Gene/Proteome Database (LMPD)
Proteins
squalene monooxygenase | |
---|---|
Refseq ID | NP_033296 |
Protein GI | 6678127 |
UniProt ID | P52019 |
mRNA ID | NM_009270 |
Length | 572 |
RefSeq Status | PROVISIONAL |
MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRCRHRHGGLLGRHQSGAQFAAFSDILSALPLIGFFWAKSPESEKKEQLESKKCRKEIGLSETTLTGAATSVSTSFVTDPEVIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGELLQPGGYRVLQELGLGDTVEGLNAHHIHGYIVHDYESRSEVQIPYPLSETNQVQSGIAFHHGRFIMSLRKAAMAEPNVKFIEGVVLQLLEEDDAVIGVQYKDKETGDTKELHAPLTVVADGLFSKFRKSLISSKVSVSSHFVGFLMKDAPQFKPNFAELVLVNPSPVLIYQISSSETRVLVDIRGELPRNLREYMAEQIYPQLPEHLKESFLEASQNGRLRTMPASFLPPSSVNKRGVLILGDAYNLRHPLTGGGMTVALKDIKLWRQLLKDIPDLYDDAAIFQAKKSFFWSRKRTHSFVVNVLAQALYELFSATDDSLHQLRKACFLYFKLGGECVTGPVGLLSILSPHPLVLIRHFFSVAIYATYFCFKSEPWATKPRALFSSGAVLYKACSILFPLIYSEMKYLVH |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0050660 | IEA:InterPro | F | flavin adenine dinucleotide binding |
GO:0004506 | IEA:UniProtKB-EC | F | squalene monooxygenase activity |
GO:0006725 | IEA:Ensembl | P | cellular aromatic compound metabolic process |
GO:0008203 | IEA:Ensembl | P | cholesterol metabolic process |
GO:0010033 | IEA:Ensembl | P | response to organic substance |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu00100 | Steroid biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Squalene + NADPH + O(2) = (3S)-2,3-epoxy-2,3- dihydrosqualene + NADP(+) + H(2)O. |
Cofactor | Name=FAD; Xref=ChEBI:CHEBI:57692; |
Function | Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway. |
Pathway | Terpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 2/3. |
Similarity | Belongs to the squalene monooxygenase family. {ECO:0000305}. |
Subcellular Location | Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. |
Subunit | May form a complex with squalene synthase. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000513 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6678127 | RefSeq | NP_033296 | 572 | squalene monooxygenase |
Identical Sequences to LMP000513 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6678127 | DBBJ | BAE37374.1 | 572 | unnamed protein product [Mus musculus] |
GI:6678127 | GenBank | AAE03453.1 | 572 | Sequence 3 from patent US 5861496 |
GI:6678127 | GenBank | AAE55205.1 | 572 | Sequence 6 from patent US 6153815 |
GI:6678127 | GenBank | AAH42781.1 | 572 | Squalene epoxidase [Mus musculus] |
GI:6678127 | GenBank | AAH56361.1 | 572 | Squalene epoxidase [Mus musculus] |
GI:6678127 | GenBank | EDL29326.1 | 572 | squalene epoxidase [Mus musculus] |
Related Sequences to LMP000513 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6678127 | DBBJ | BAA07141.1 | 573 | squalene epoxidase [Rattus norvegicus] |
GI:6678127 | GenBank | AAE55206.1 | 573 | Sequence 7 from patent US 6153815 |
GI:6678127 | GenBank | AAH97330.1 | 573 | Sqle protein [Rattus norvegicus] |
GI:6678127 | GenBank | EDM16202.1 | 573 | squalene epoxidase [Rattus norvegicus] |
GI:6678127 | RefSeq | NP_058832.1 | 573 | squalene monooxygenase [Rattus norvegicus] |
GI:6678127 | SwissProt | P52020.1 | 573 | RecName: Full=Squalene monooxygenase; AltName: Full=Squalene epoxidase; Short=SE [Rattus norvegicus] |