Gene/Proteome Database (LMPD)
LMPD ID
LMP000536
Gene ID
Species
Homo sapiens (Human)
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Gene Symbol
Synonyms
ATP5A
Alternate Names
ATP synthase F(0) complex subunit C2, mitochondrial; ATPase protein 9; ATPase subunit C; ATP synthase c subunit; ATP synthase proteolipid P2; ATP synthase lipid-binding protein, mitochondrial; mitochondrial ATP synthase, subunit C (subunit 9), isoform 2; ATP synthase proton-transporting mitochondrial F(0) complex subunit C2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9); ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2
Chromosome
12
Map Location
12q13.13
Summary
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The proton channel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). There are three separate genes which encode subunit c of the proton channel and they specify precursors with different import sequences but identical mature proteins. The protein encoded by this gene is one of three precursors of subunit c. Alternatively spliced transcript variants encoding different isoforms have been identified. This gene has multiple pseudogenes. [provided by RefSeq, Jun 2010]
Orthologs
Proteins
| ATP synthase F(0) complex subunit C2, mitochondrial isoform a precursor | |
|---|---|
| Refseq ID | NP_001002031 |
| Protein GI | 50593533 |
| UniProt ID | Q06055 |
| mRNA ID | NM_001002031 |
| Length | 157 |
| RefSeq Status | REVIEWED |
| MPELILSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
| ATP synthase F(0) complex subunit C2, mitochondrial isoform b precursor | |
|---|---|
| Refseq ID | NP_005167 |
| Protein GI | 85794840 |
| UniProt ID | Q06055 |
| mRNA ID | NM_005176 |
| Length | 198 |
| RefSeq Status | REVIEWED |
| MPELILYVAITLSVAERLVGPGHACAEPSFRSSRCSAPLCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
| transit_peptide: 1..82 calculated_mol_wt: 8744 peptide sequence: MPELILSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISR mat_peptide: 83..157 product: ATP synthase F(0) complex subunit C2, mitochondrial isoform a calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM transit_peptide: 1..123 calculated_mol_wt: 12923 peptide sequence: MPELILYVAITLSVAERLVGPGHACAEPSFRSSRCSAPLCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISR mat_peptide: 124..198 product: ATP synthase F(0) complex subunit C2, mitochondrial isoform b calculated_mol_wt: 7608 peptide sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM | |
Gene Information
Entrez Gene ID
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005753 | TAS:ProtInc | C | mitochondrial proton-transporting ATP synthase complex |
| GO:0045263 | IEA:UniProtKB-KW | C | proton-transporting ATP synthase complex, coupling factor F(o) |
| GO:0015078 | IEA:InterPro | F | hydrogen ion transmembrane transporter activity |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0005215 | NAS:ProtInc | F | transporter activity |
| GO:0015991 | IEA:InterPro | P | ATP hydrolysis coupled proton transport |
| GO:0015986 | IEA:InterPro | P | ATP synthesis coupled proton transport |
| GO:0045471 | IEA:Ensembl | P | response to ethanol |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Protein Entry
AT5G2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q06055-1; Sequence=Displayed; Name=2; IsoId=Q06055-2; Sequence=VSP_037348; Note=Derived from EST data.; Name=3; IsoId=Q06055-3; Sequence=VSP_037349; Note=Derived from EST data.; |
| Function | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. |
| Miscellaneous | There are three genes which encode the mitochondrial ATP synthase proteolipid and they specify precursors with different import sequences but identical mature proteins. Is the major protein stored in the storage bodies of animals or humans affected with ceroid lipofuscinosis (Batten disease). |
| Similarity | Belongs to the ATPase C chain family. |
| Subcellular Location | Mitochondrion membrane; Multi-pass membrane protein. |
| Subunit | F-type ATPases have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). CF(0) has three main subunits: a, b and c. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000536 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 50593533 | RefSeq | NP_001002031 | 157 | ATP synthase F(0) complex subunit C2, mitochondrial isoform a precursor |
| 85794840 | RefSeq | NP_005167 | 198 | ATP synthase F(0) complex subunit C2, mitochondrial isoform b precursor |
Identical Sequences to LMP000536 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:85794840 | GenBank | ABJ47109.1 | 198 | Sequence 7848 from patent US 7115416 |
| GI:85794840 | GenBank | EAW96725.1 | 198 | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), isoform CRA_a [Homo sapiens] |
| GI:85794840 | GenBank | JAA13235.1 | 198 | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) [Pan troglodytes] |
| GI:85794840 | GenBank | JAA42783.1 | 198 | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) [Pan troglodytes] |
| GI:85794840 | RefSeq | XP_509102.2 | 198 | PREDICTED: ATP synthase F(0) complex subunit C2, mitochondrial isoform X1 [Pan troglodytes] |
| GI:50593533 | RefSeq | XP_003313695.1 | 157 | PREDICTED: ATP synthase F(0) complex subunit C2, mitochondrial isoform X2 [Pan troglodytes] |
| GI:85794840 | RefSeq | XP_008954639.1 | 198 | PREDICTED: ATP synthase F(0) complex subunit C2, mitochondrial isoform X1 [Pan paniscus] |
Related Sequences to LMP000536 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:85794840 | GenBank | AFJ70366.1 | 198 | ATP synthase lipid-binding protein, mitochondrial isoform b precursor [Macaca mulatta] |
| GI:50593533 | GenBank | JAA08212.1 | 157 | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) [Pan troglodytes] |
| GI:50593533 | RefSeq | NP_005167.2 | 198 | ATP synthase F(0) complex subunit C2, mitochondrial isoform b precursor [Homo sapiens] |
| GI:50593533 | RefSeq | XP_003252090.1 | 157 | PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Nomascus leucogenys] |
| GI:85794840 | RefSeq | XP_004053295.1 | 198 | PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Gorilla gorilla gorilla] |
| GI:50593533 | RefSeq | XP_004053296.1 | 157 | PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Gorilla gorilla gorilla] |
| GI:85794840 | RefSeq | XP_004053298.1 | 198 | PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 4 [Gorilla gorilla gorilla] |
| GI:85794840 | RefSeq | XP_004089669.1 | 198 | PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Nomascus leucogenys] |
| GI:85794840 | RefSeq | XP_005571096.1 | 198 | PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Macaca fascicularis] |
| GI:85794840 | RefSeq | XP_008001664.1 | 198 | PREDICTED: ATP synthase F(0) complex subunit C2, mitochondrial [Chlorocebus sabaeus] |
| GI:50593533 | RefSeq | XP_008954639.1 | 198 | PREDICTED: ATP synthase F(0) complex subunit C2, mitochondrial isoform X1 [Pan paniscus] |
| GI:50593533 | RefSeq | XP_009246092.1 | 157 | PREDICTED: ATP synthase F(0) complex subunit C2, mitochondrial isoform X2 [Pongo abelii] |