Gene/Proteome Database (LMPD)
LMPD ID
LMP000539
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidic acid phosphatase type 2A
Gene Symbol
Synonyms
LLP1a; LPP1; PAP-2a; PAP2
Alternate Names
lipid phosphate phosphohydrolase 1; phosphatidic acid phosphatase 2a; lipid phosphate phosphohydrolase 1a; phosphatidate phosphohydrolase type 2a; phosphatidic acid phosphohydrolase type 2a; type-2 phosphatidic acid phosphatase alpha
Chromosome
5
Map Location
5q11
EC Number
3.1.3.4
Summary
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]
Orthologs
Proteins
| lipid phosphate phosphohydrolase 1 isoform 1 | |
|---|---|
| Refseq ID | NP_003702 |
| Protein GI | 29171736 |
| UniProt ID | O14494 |
| mRNA ID | NM_003711 |
| Length | 284 |
| RefSeq Status | REVIEWED |
| MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP | |
| lipid phosphate phosphohydrolase 1 isoform 2 | |
|---|---|
| Refseq ID | NP_795714 |
| Protein GI | 29171738 |
| UniProt ID | O14494 |
| mRNA ID | NM_176895 |
| Length | 285 |
| RefSeq Status | REVIEWED |
| MFDKTRLPYVALDVLCVLLASMPMAVLKLGQIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidic acid phosphatase type 2A
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0005887 | NAS:UniProtKB | C | integral component of plasma membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0005886 | TAS:Reactome | C | plasma membrane |
| GO:0008195 | IDA:UniProtKB | F | phosphatidate phosphatase activity |
| GO:0030521 | NAS:UniProtKB | P | androgen receptor signaling pathway |
| GO:0008354 | TAS:ProtInc | P | germ cell migration |
| GO:0030518 | TAS:UniProtKB | P | intracellular steroid hormone receptor signaling pathway |
| GO:0006629 | NAS:ProtInc | P | lipid metabolic process |
| GO:0008285 | NAS:UniProtKB | P | negative regulation of cell proliferation |
| GO:0046839 | TAS:UniProtKB | P | phospholipid dephosphorylation |
| GO:0006470 | IEA:Ensembl | P | protein dephosphorylation |
| GO:0007205 | TAS:UniProtKB | P | protein kinase C-activating G-protein coupled receptor signaling pathway |
| GO:0019216 | NAS:UniProtKB | P | regulation of lipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0030148 | TAS:Reactome | P | sphingolipid biosynthetic process |
| GO:0006665 | TAS:Reactome | P | sphingolipid metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04975 | Fat digestion and absorption |
| hsa04666 | Fc gamma R-mediated phagocytosis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_115810 | Sphingolipid de novo biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidic acid phosphatase type 2A
Protein Entry
LPP1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Comment=Additional isoforms seem to exist.; Name=1; Synonyms=Alpha-1, hLPP1, PAP2-a1; IsoId=O14494-1; Sequence=Displayed; Name=2; Synonyms=Alpha-2, hLPP1-a, PAP2-a2; IsoId=O14494-2; Sequence=VSP_009651; Note=Ref.2 (AAC16033) sequence is in conflict in positions: 55:V->A, 56:T->A, 69:I->V. ; |
| Catalytic Activity | A 1,2-diacylglycerol 3-phosphate + H(2)O = a 1,2-diacyl-sn-glycerol + phosphate. |
| Caution | PubMed:9305923 states that this phosphatase does not hydrolyze sphingosine 1-phosphate while PubMed:9705349 states that it does. |
| Enzyme Regulation | Inhibited by sphingosine, zinc ions and propanolol. Not inhibited by N-ethylmaleimide treatment. |
| Function | Broad-specificity phosphohydrolase that dephosphorylates exogenous bioactive glycerolipids and sphingolipids. Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). Pivotal regulator of lysophosphatidic acid (LPA) signaling in the cardiovascular system. Major enzyme responsible of dephosphorylating LPA in platelets, which terminates signaling actions of LPA. May control circulating, and possibly also regulate localized, LPA levels resulting from platelet activation. It has little activity towards ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is LPA > PA > S-1-P > C-1-P. It's down-regulation may contribute to the development of colon adenocarcinoma. |
| Induction | By androgens. |
| Ptm | N-glycosylated. Contains high-mannose oligosaccharides. |
| Similarity | Belongs to the PA-phosphatase related phosphoesterase family. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. |
| Subunit | Homodimer. |
| Tissue Specificity | Ubiquitously expressed with highest expression found in prostate. Isoform 1 is predominant in kidney, lung, placenta and liver. Isoform 2 is predominant in heart and pancreas. Found to be down-regulated in colon adenocarcinomas. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000539 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 29171736 | RefSeq | NP_003702 | 284 | lipid phosphate phosphohydrolase 1 isoform 1 |
| 29171738 | RefSeq | NP_795714 | 285 | lipid phosphate phosphohydrolase 1 isoform 2 |
Identical Sequences to LMP000539 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:29171736 | EMBL | CCF77023.1 | 284 | unnamed protein product [Homo sapiens] |
| GI:29171738 | EMBL | CCF77024.1 | 285 | unnamed protein product [Homo sapiens] |
| GI:29171738 | GenBank | AAE73273.1 | 285 | Sequence 1 from patent US 6242179 |
| GI:29171738 | GenBank | EAW54922.1 | 285 | phosphatidic acid phosphatase type 2A, isoform CRA_b [Homo sapiens] |
| GI:29171738 | GenBank | EAW54923.1 | 285 | phosphatidic acid phosphatase type 2A, isoform CRA_b [Homo sapiens] |
| GI:29171736 | GenBank | AEU56619.1 | 284 | Sequence 131 from patent US 8067189 |
| GI:29171736 | GenBank | AEU56630.1 | 284 | Sequence 142 from patent US 8067189 |
| GI:29171736 | GenBank | AFQ72514.1 | 284 | Sequence 1 from patent US 8232069 |
| GI:29171736 | GenBank | AHD71053.1 | 284 | Sequence 4521 from patent US 8586006 |
| GI:29171738 | GenBank | AHD71054.1 | 285 | Sequence 4522 from patent US 8586006 |
| GI:29171736 | GenBank | AIC50158.1 | 284 | PPAP2A, partial [synthetic construct] |
Related Sequences to LMP000539 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:29171736 | GenBank | AAC32041.1 | 289 | type-2 phosphatidic acid phosphohydrolase [Homo sapiens] |
| GI:29171738 | GenBank | AAC16033.1 | 285 | type-2 phosphatidic acid phosphatase alpha-2 [Homo sapiens] |
| GI:29171738 | GenBank | ABL31791.1 | 285 | Sequence 4 from patent US 7135314 |
| GI:29171738 | GenBank | ABL31796.1 | 285 | Sequence 11 from patent US 7135314 |
| GI:29171736 | RefSeq | XP_517759.2 | 284 | PREDICTED: lipid phosphate phosphohydrolase 1 isoform X2 [Pan troglodytes] |
| GI:29171738 | RefSeq | XP_001146001.1 | 285 | PREDICTED: lipid phosphate phosphohydrolase 1 isoform X1 [Pan troglodytes] |
| GI:29171736 | RefSeq | XP_003265977.1 | 284 | PREDICTED: lipid phosphate phosphohydrolase 1 isoform 1 [Nomascus leucogenys] |
| GI:29171738 | RefSeq | XP_003265978.1 | 285 | PREDICTED: lipid phosphate phosphohydrolase 1 isoform 2 [Nomascus leucogenys] |
| GI:29171736 | RefSeq | XP_004058895.1 | 466 | PREDICTED: lipid phosphate phosphohydrolase 1 isoform 1 [Gorilla gorilla gorilla] |
| GI:29171738 | RefSeq | XP_004058896.1 | 467 | PREDICTED: lipid phosphate phosphohydrolase 1 isoform 2 [Gorilla gorilla gorilla] |
| GI:29171736 | RefSeq | XP_005556961.1 | 284 | PREDICTED: lipid phosphate phosphohydrolase 1 isoform X2 [Macaca fascicularis] |
| GI:29171736 | RefSeq | XP_007970789.1 | 284 | PREDICTED: lipid phosphate phosphohydrolase 1 isoform X3 [Chlorocebus sabaeus] |